Property Summary

NCBI Gene PubMed Count 21
PubMed Score 61.29
PubTator Score 94.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma -1.100 7.6e-05
posterior fossa group B ependymoma 1.200 1.2e-05

Gene RIF (12)

AA Sequence

MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLFPPPFFRGG      1 - 70
RSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKGEKGELGRPGRKGRPGPPGVP     71 - 140
GMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPGSRGEKGSRGEKGDLGPKGEKGFPGFPGMLG    141 - 210
QKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKG    211 - 280
ERGFPGPPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKD    281 - 350
SLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS    351 - 420
DFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT                                       421 - 455
//

Text Mined References (23)

PMID Year Title