Property Summary

NCBI Gene PubMed Count 157
Grant Count 172
R01 Count 111
Funding $17,307,321.39
PubMed Score 617.40
PubTator Score 491.28

Knowledge Summary

Patent (9,162)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.027
psoriasis -1.100 0.009
cystic fibrosis -4.490 0.000
atypical teratoid / rhabdoid tumor 1.200 0.005
non-small cell lung carcinoma -1.500 0.000
lung cancer -3.700 0.000
lung adenocarcinoma -1.200 0.000
posterior fossa group B ependymoma 1.400 0.001

Synonym

Accession Q9Y210 Q52M59 Q9HCW3 Q9NQA8 Q9NQA9 TrpC6
Symbols TRP6
FSGS2

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (135)

PMID Text
26913924 This study described the expression and functional relevance of TRPC6 in the pathophysiology of HK-2 cell following ischemia reperfusion.
26858457 These findings suggest that lysoPC induces CaM phosphorylation at Tyr(99) by a Src family kinase and that phosphorylated CaM activates PI3K to produce PIP3, which promotes TRPC6 translocation to the cell membrane.
26849622 Insulin increases the expression of TRPC6 channels in podocytes by activation of the calcineurin-dependent pathway.
26604306 the transient receptor potential canonical-6 (TRPC6) calcium-permeable channel in the alveolar macrophages also functions to shunt the transmembrane potential generated by proton pumping.
26581893 TRPC6 specifically interacts with APP leading to inhibition of its cleavage by gamma-secretase and reduction in Abeta production.
26531690 TRPC6 genetic variants are promising candidate predictors of nervous system involvement in systemic lupus erythematosus
26392222 Selectively activating endothelial TRPC6 rescues transendothelial migration
26386308 TRPC6 plays a prominent role in thrombin-evoked delta-granule platelet exocytosis and calcium mobilization.
26348127 distribution and activity of TRPC6 can be regulated by cardiotonic steroids like ouabain and the naturally occurring peptide Abeta(1-40) which underlines the pathophysiological significance of these processes.
26239116 these findings provide strong evidence for a role of immunophilins, including FKBP25 and FKBP38, in NCCE mediated by TRPC6.
More...

AA Sequence

MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGSDNRLAHRRQT      1 - 70
VLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLA     71 - 140
VANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYD    141 - 210
EDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGL    211 - 280
ASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDV    281 - 350
ETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL    351 - 420
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNAKQLFRMKTSC    421 - 490
FSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA    491 - 560
NDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRT    561 - 630
VKDIFKFMVIFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFI    631 - 700
ENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSP    701 - 770
KSLFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS    771 - 840
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLEEKSQNTEDLA    841 - 910
ELIRELGEKLSMEPNQEETNR                                                     911 - 931
//

Text Mined References (159)

PMID Year Title
26913924 2016 TRPC6 May Protect Renal Ischemia-Reperfusion Injury Through Inhibiting Necroptosis of Renal Tubular Epithelial Cells.
26858457 2016 Membrane translocation of TRPC6 channels and endothelial migration are regulated by calmodulin and PI3 kinase activation.
26849622 2016 Insulin Increases Expression of TRPC6 Channels in Podocytes by a Calcineurin-Dependent Pathway.
26604306 2015 TRPC6 channel translocation into phagosomal membrane augments phagosomal function.
26581893 2015 TRPC6 specifically interacts with APP to inhibit its cleavage by ?-secretase and reduce A? production.
26531690 2015 TRPC6 gene variants and neuropsychiatric lupus.
26392222 2015 TRPC6 is the endothelial calcium channel that regulates leukocyte transendothelial migration during the inflammatory response.
26386308 2015 Relationship between calcium mobilization and platelet ?- and ?-granule secretion. A role for TRPC6 in thrombin-evoked ?-granule exocytosis.
26348127 2015 The Na+/K+-ATPase and the amyloid-beta peptide a?1-40 control the cellular distribution, abundance and activity of TRPC6 channels.
26239116 2015 FKBP25 and FKBP38 regulate non-capacitative calcium entry through TRPC6.
More...