Property Summary

Ligand Count 22
NCBI Gene PubMed Count 165
PubMed Score 661.60
PubTator Score 491.28

Knowledge Summary

Patent (9,162)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 5.4e-03
cutaneous lupus erythematosus -1.100 2.7e-02
cystic fibrosis -4.490 1.3e-07
lung adenocarcinoma -1.200 2.2e-07
lung cancer -2.100 1.7e-03
non-small cell lung cancer -1.312 2.1e-12
posterior fossa group B ependymoma 1.400 7.9e-04
psoriasis -1.100 8.8e-03

Gene RIF (143)

AA Sequence

MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGSDNRLAHRRQT      1 - 70
VLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEECHSLNVNCVDYMGQNALQLA     71 - 140
VANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYD    141 - 210
EDGTRFSHDVTPIILAAHCQEYEIVHTLLRKGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGL    211 - 280
ASPAYLSLSSEDPVMTALELSNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDV    281 - 350
ETLQSGDHGRPNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL    351 - 420
ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNAKQLFRMKTSC    421 - 490
FSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASFIARFMAFWHASKAQSIIDA    491 - 560
NDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRT    561 - 630
VKDIFKFMVIFIMVFVAFMIGMFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFI    631 - 700
ENIGYVLYGVYNVTMVIVLLNMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSP    701 - 770
KSLFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS    771 - 840
EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLEEKSQNTEDLA    841 - 910
ELIRELGEKLSMEPNQEETNR                                                     911 - 931
//

Text Mined References (170)

PMID Year Title