Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.64
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.300 3.8e-02
Breast cancer 2.300 2.8e-02
glioblastoma 1.300 4.6e-03
group 3 medulloblastoma -1.500 3.1e-03
Multiple Sclerosis 1.500 1.2e-04
posterior fossa group A ependymoma 1.100 1.9e-05
psoriasis -1.900 7.1e-05

AA Sequence

MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCTKLANMYSTSTDCREH      1 - 70
CRRGMKAKQLKAEAGRSCQRKGVPIQTPREHSWISCKKEFEANP                               71 - 114
//

Text Mined References (7)

PMID Year Title