Property Summary

NCBI Gene PubMed Count 42
PubMed Score 56.10
PubTator Score 151.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (31)

Disease log2 FC p
psoriasis 1.800 6.2e-07
active Crohn's disease 1.557 8.0e-03
acute myeloid leukemia 1.900 4.4e-02
adrenocortical carcinoma 1.100 2.1e-02
adult high grade glioma 1.200 9.9e-04
Atopic dermatitis 1.600 6.8e-04
atypical teratoid / rhabdoid tumor 1.900 6.5e-05
Breast cancer 1.300 4.5e-03
breast carcinoma 1.200 6.1e-17
cutaneous lupus erythematosus 2.300 1.2e-04
cystic fibrosis 2.100 1.6e-03
diabetes mellitus 1.700 1.9e-03
ductal carcinoma in situ 2.800 1.2e-03
glioblastoma 1.300 6.4e-05
interstitial cystitis 3.200 2.1e-04
intraductal papillary-mucinous carcinoma... -1.300 3.1e-02
invasive ductal carcinoma 1.147 1.7e-02
lung adenocarcinoma -1.700 3.5e-05
lung cancer -7.000 2.3e-08
lung carcinoma -5.600 2.2e-45
malignant mesothelioma -1.300 4.1e-06
Multiple myeloma 2.496 2.3e-03
Multiple Sclerosis 2.400 3.0e-02
non-small cell lung cancer -2.807 9.5e-21
osteosarcoma -1.516 6.5e-03
ovarian cancer 1.700 3.8e-03
pancreatic ductal adenocarcinoma liver m... 1.400 3.7e-02
primary Sjogren syndrome 2.200 3.0e-04
spina bifida -1.288 4.0e-02
tuberculosis -1.600 4.2e-03
ulcerative colitis 3.300 7.7e-08

 CSPA Cell Line (4)

Pathway (1)

Gene RIF (34)

AA Sequence

MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMD      1 - 70
GHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITP     71 - 140
PAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPAST    141 - 210
VPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSN    211 - 280
LLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAH    281 - 350
LQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI        351 - 416
//

Text Mined References (43)

PMID Year Title