Property Summary

NCBI Gene PubMed Count 38
Grant Count 29
R01 Count 16
Funding $3,628,941.09
PubMed Score 54.45
PubTator Score 151.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26263981 our results suggest that epithelial LAMP3 expression is an independent prognostic biomarker for esophageal squamous cell carcinoma .
26191259 In laryngeal squamous cell carcinoma, high LAMP3 and high TP53 protein expression was significantly associated with tumor stage and size and patients with high expression of these proteins had poor overall survival.
25681212 LAMP3 regulation as part of the unfolded protein response contributes to protein degradation and cell survival during proteasomal dysfunction.
25362357 LAMP3 and TP53 protein expression was significantly higher in cancerous gastrointestinal tissues compared to normal and benign tissues; only LAMP3 expression correlated with poor overall survival
24634103 LAMP3 gene expression is relevant for prognosis in squamous cell carcinoma of head and neck.
24631562 the MCCC1/LAMP3 gene can decrease the risk of Parkinson disease in Chinese population.
24434718 LAMP3 knockdown in MCF7 breast cancer cells increases tamoxifen sensitivity.
24162774 HIV-1 gp120 downregulates the expression of lysosomal-associated membrane protein 3 (LAMP3) in human B cells
24081865 Increase in CD208+ dendritic cells in tonsils is associated with immunoglobulin A nephropathy
24045183 the association between hypoxia, metastasis, and poor prognosis is due, in part, to hypoxic activation of the unfolded protein response and expression of LAMP3.
More...

AA Sequence

MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMD      1 - 70
GHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITP     71 - 140
PAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPAST    141 - 210
VPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSN    211 - 280
LLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAH    281 - 350
LQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI        351 - 416
//

Text Mined References (39)

PMID Year Title
26263981 2015 High Expression of LAMP3 Is a Novel Biomarker of Poor Prognosis in Patients with Esophageal Squamous Cell Carcinoma.
26191259 2015 LAMP3 and TP53 overexpression predicts poor outcome in laryngeal squamous cell carcinoma.
25681212 Loss of lysosome-associated membrane protein 3 (LAMP3) enhances cellular vulnerability against proteasomal inhibition.
25362357 2014 Prognostic value of LAMP3 and TP53 overexpression in benign and malignant gastrointestinal tissues.
24634103 2015 Hypoxic regulation of the PERK/ATF4/LAMP3-arm of the unfolded protein response in head and neck squamous cell carcinoma.
24631562 2014 Association analysis of STK39, MCCC1/LAMP3 and sporadic PD in the Chinese Han population.
24434718 2014 LAMP3 is involved in tamoxifen resistance in breast cancer cells through the modulation of autophagy.
24081865 2013 Clinical and immunological implications of increase in CD208+ dendritic cells in tonsils of patients with immunoglobulin A nephropathy.
24045183 2013 Hypoxic activation of the PERK/eIF2? arm of the unfolded protein response promotes metastasis through induction of LAMP3.
23876802 2013 DC-LAMP+ dendritic cells are recruited to gastric lymphoid follicles in Helicobacter pylori-infected individuals.
More...