Property Summary

NCBI Gene PubMed Count 49
Grant Count 58
R01 Count 38
Funding $5,395,473.26
PubMed Score 60.68
PubTator Score 49.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.500 0.005
gastric cancer 1.100 0.001
psoriasis 1.800 0.000
osteosarcoma 3.503 0.000
glioblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -1.600 0.000
Crohn's disease -1.132 0.001
ulcerative colitis -1.373 0.000
pancreatic ductal adenocarcinoma liver m... 1.358 0.010
pediatric high grade glioma -1.400 0.000
group 4 medulloblastoma 1.200 0.000
acute myeloid leukemia 1.500 0.021
Pick disease 1.600 0.000
ovarian cancer -1.300 0.000

Pathway (1)

Gene RIF (30)

PMID Text
26891870 A larger role ZBP-89 plays in gene regulation during inflammation.ZBP-89 regulates of MMP-1 expression.ZBP-89 and NF-kappaB appear to bind cooperatively on both promoters.
25623232 ZBP-89 attenuates HDAC3 by increasing IkappaB degradation, dependent on Pin1 but independent of NF-Kappab
23954442 zinc-binding protein-89 upregulates the expression of Bak by targeting multiple components of the epigenetic pathway in hepatocellular carcinoma.
23576061 lower expression of ZNF148 in colorectal cancer was significantly associated with worse clinicopathologic variables, including lymph node metastases, poor differentiation, and a higher rate of disease recurrence
22982674 this study provides vigorous evidence that ZBP-89 was significantly downregulated in clear cell renal cell carcinoma(CCRCC) and could be served as a promising biomarker for prediction of distal metastasis and prognosis of patient with CCRCC.
22372401 Colony formation was reduced dramatically in those hepatocellular carcinoma cell lines in which ZBP-89 overexpression was demonstrated; this appeared to correlate with increased apoptosis.
22214764 We found that the TP53-G245D variant but not TP53-R249S abrogated HDAC inhibitor p21 induction by binding to ZBP-89 and retaining it in the cytoplasm.
22111549 ZBP-89 is a regulator of Pdcd4 gene, binding to the basal promoter either alone or by interacting with Sp family members.
21828133 An activating role for ZBP-89 in human globin gene regulation and erythroid differentiation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAADEVLQESEMR      1 - 70
QQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPISVKQEITFTDVSEQLMRDKKQIREPVDL     71 - 140
QKKKKRKQRSPAKILTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQ    141 - 210
KYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHEN    211 - 280
HDKKLNRCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYS    281 - 350
SSTKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLEQNQTISPLSTYEES    351 - 420
KVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDDAMQFLKKKRYLQAASNNSREYALN    421 - 490
VGTIASQPSVTQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEVLQTLLDHYSHKANGQHEISF    491 - 560
SVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKANMLQEYSKFLQQALDRTSQNDAYLNSPSLNF    561 - 630
VTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASAT    631 - 700
STQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFP    701 - 770
LVNVNDNRAGMTSSPDATTGQTFG                                                  771 - 794
//

Text Mined References (62)

PMID Year Title
26891870 2016 Zinc-binding protein-89 (ZBP-89) cooperates with NF-?B to regulate expression of matrix metalloproteinases (MMPs) in response to inflammatory cytokines.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25623232 2015 ZBP-89 reduces histone deacetylase 3 by degrading IkappaB in the presence of Pin1.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954442 2013 Epigenetic upregulation of Bak by ZBP-89 inhibits the growth of hepatocellular carcinoma.
23576061 2013 Expression of ZNF148 in different developing stages of colorectal cancer and its prognostic value: a large Chinese study based on tissue microarray.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...