Property Summary

NCBI Gene PubMed Count 5
PubMed Score 25.48
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ulcerative colitis 1819 4.1e-07
pituitary cancer 1972 2.1e-04
osteosarcoma 7950 5.3e-03
active Crohn's disease 922 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Gastrointestinal lymphoma 2 3.96 2.0
Gastric lymphoma 7 3.269 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.031 1.0e-02
osteosarcoma -1.017 5.3e-03
pituitary cancer 1.600 2.1e-04
ulcerative colitis -1.600 4.1e-07

Gene RIF (1)

AA Sequence

MQWTKVLGLGLGAAALLGLGIILGHFAIPKKANSLAPQDLDLEILETVMGQLDAHRIRENLRELSREPHL      1 - 70
ASSPRDEDLVQLLLQRWKDPESGLDSAEASTYEVLLSFPSQEQPNVVDIVGPTGGIIHSCHRTEENVTGE     71 - 140
QGGPDVVQPYAAYAPSGTPQGLLVYANRGAEEDFKELQTQGIKLEGTIALTRYGGVGRGAKAVNAAKHGV    141 - 210
AGVLVYTDPADINDGLSSPDETFPNSWYLPPSGVERGSYYEYFGDPLTPYLPAVPSSFRVDLANVSGFPP    211 - 280
IPTQPIGFQDARDLLCNLNGTLAPATWQGALGCHYRLGPGFRPDGDFPADSQVNVSVYNRLELRNSSNVL    281 - 350
GIIRGAVEPDRYVLYGNHRDSWVHGAVDPSSGTAVLLELSRVLGTLLKKGTWRPRRSIVFASWGAEEFGL    351 - 420
IGSTEFTEEFFNKLQERTVAYINVDISVFANATLRVQGTPPVQSVVFSATKEIRSPGPGDLSIYDNWIRY    421 - 490
FNRSSPVYGLVPSLGSLGAGSDYAPFVHFLGISSMDIAYTYDRSKTSARIYPTYHTAFDTFDYVDKFLDP    491 - 560
GFSSHQAVARTAGSVILRLSDSFFLPLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVTAVEKFEA    561 - 630
EAAALGQRISTLQKGSPDPLQVRMLNDQLMLLERTFLNPRAFPEERYYSHVLWAPRTGSVVTFPGLSNAC    631 - 700
SRARDTASGSEAWAEVQRQLSIVVTALEGAAATLRPVADL                                  701 - 740
//

Text Mined References (6)

PMID Year Title