Property Summary

NCBI Gene PubMed Count 5
Grant Count 1
Funding $149,457
PubMed Score 25.29
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.107 0.000
active Crohn's disease -1.031 0.010
ulcerative colitis -1.700 0.000
pituitary cancer 1.600 0.000

Gene RIF (1)

PMID Text
25752612 characterization of the protein product of the human NAALADL1 gene

AA Sequence

MQWTKVLGLGLGAAALLGLGIILGHFAIPKKANSLAPQDLDLEILETVMGQLDAHRIRENLRELSREPHL      1 - 70
ASSPRDEDLVQLLLQRWKDPESGLDSAEASTYEVLLSFPSQEQPNVVDIVGPTGGIIHSCHRTEENVTGE     71 - 140
QGGPDVVQPYAAYAPSGTPQGLLVYANRGAEEDFKELQTQGIKLEGTIALTRYGGVGRGAKAVNAAKHGV    141 - 210
AGVLVYTDPADINDGLSSPDETFPNSWYLPPSGVERGSYYEYFGDPLTPYLPAVPSSFRVDLANVSGFPP    211 - 280
IPTQPIGFQDARDLLCNLNGTLAPATWQGALGCHYRLGPGFRPDGDFPADSQVNVSVYNRLELRNSSNVL    281 - 350
GIIRGAVEPDRYVLYGNHRDSWVHGAVDPSSGTAVLLELSRVLGTLLKKGTWRPRRSIVFASWGAEEFGL    351 - 420
IGSTEFTEEFFNKLQERTVAYINVDISVFANATLRVQGTPPVQSVVFSATKEIRSPGPGDLSIYDNWIRY    421 - 490
FNRSSPVYGLVPSLGSLGAGSDYAPFVHFLGISSMDIAYTYDRSKTSARIYPTYHTAFDTFDYVDKFLDP    491 - 560
GFSSHQAVARTAGSVILRLSDSFFLPLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVTAVEKFEA    561 - 630
EAAALGQRISTLQKGSPDPLQVRMLNDQLMLLERTFLNPRAFPEERYYSHVLWAPRTGSVVTFPGLSNAC    631 - 700
SRARDTASGSEAWAEVQRQLSIVVTALEGAAATLRPVADL                                  701 - 740
//

Text Mined References (6)

PMID Year Title
25752612 2015 Structural and biochemical characterization of a novel aminopeptidase from human intestine.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10085079 1999 Isolation and expression of novel human glutamate carboxypeptidases with N-acetylated alpha-linked acidic dipeptidase and dipeptidyl peptidase IV activity.
9388249 1997 Cloning and characterization of a novel peptidase from rat and human ileum.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.