Property Summary

NCBI Gene PubMed Count 133
Grant Count 17
R01 Count 14
Funding $1,505,011.9
PubMed Score 47.54
PubTator Score 46.49

Knowledge Summary

Patent (2,660)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytic glioma -2.400 0.001
posterior fossa group B ependymoma -3.600 0.000
oligodendroglioma -2.400 0.014
glioblastoma -4.300 0.000
osteosarcoma 1.018 0.001
medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -4.100 0.000
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -2.900 0.000
ovarian cancer 1.300 0.000

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (51)

PMID Text
25815641 CaMKII phosphorylates SCN5A in vitro on 23 novel serine sites as was identified by mass spectrometry; reduced S516 phosphorylation has been found in human heart failure.
25290264 Ca2+/calmodulin-dependent protein kinase-II (CaMKII) has a key role in the plasticity of glutamatergic synapses of the brain.
24855644 a novel regulation of CaMKII by another second messenger system and indicate its involvement in excitotoxic neuronal cell death.
24614225 CaMKII-mediated recruitment and upregulation of CYLD is expected to remove K63-linked polyubiquitins and facilitate proteasomal degradation at the postsynaptic density.
24407174 Overexpression of a T253D phosphomimic form of calcium/calmodulin-dependent protein kinase type II subunit alpha significantly decreases proliferation, and cells accumulate in mitosis, specifically in metaphase.
24384746 CAMK2A SNPs were associated with Alzheimer disease and mild cognitive impairment. AG genotype at the CAMK2A-rs3822606 was associated with AD risk.
23695276 we describe for the first time, two patients with MFD and ID and for whom a deletion encompassing TCOF1 and CAMK2A has been identified
23459588 found seven significant associations between CAMK2A SNPs and alcohol dependence, one of which in an autophosphorylation-related area of the gene.
23402759 These results suggest that Osterix is a novel target of CaMKII and the activity of Osterix can be modulated by a novel mechanism involving CaMKII during osteoblast differentiation.
22824813 results suggest that the CAMK2A gene may influence spatial and non-SWM performance in humans without any corresponding gross changes in frontal cortex or hippocampal anatomy.
More...

AA Sequence

MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHP      1 - 70
NIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPEN     71 - 140
LLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGY    141 - 210
PPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASC    211 - 280
MHRQETVDCLKKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEI    281 - 350
IKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH    351 - 420
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH                421 - 478
//

Text Mined References (135)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25815641 2015 CaMKII Phosphorylation of Na(V)1.5: Novel in Vitro Sites Identified by Mass Spectrometry and Reduced S516 Phosphorylation in Human Heart Failure.
25290264 2014 ?CaMKII controls the establishment of cocaine's reinforcing effects in mice and humans.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24855644 2014 Nitric oxide induces Ca2+-independent activity of the Ca2+/calmodulin-dependent protein kinase II (CaMKII).
24614225 2014 CaMKII mediates recruitment and activation of the deubiquitinase CYLD at the postsynaptic density.
24407174 2014 Dephosphorylation of CaMKII at T253 controls the metaphase-anaphase transition.
24384746 Reelin signaling pathway genotypes and Alzheimer disease in a Spanish population.
23805378 2013 CAMKII and calcineurin regulate the lifespan of Caenorhabditis elegans through the FOXO transcription factor DAF-16.
23695276 2014 Large deletions encompassing the TCOF1 and CAMK2A genes are responsible for Treacher Collins syndrome with intellectual disability.
More...