Property Summary

NCBI Gene PubMed Count 77
Grant Count 144
R01 Count 96
Funding $12,652,480.97
PubMed Score 127.61
PubTator Score 107.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma -1.300 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.100 0.000
subependymal giant cell astrocytoma -1.124 0.019
non-inflammatory breast cancer -1.300 0.000

Synonym

Accession Q9UQL6 C9JFV9 O60340 O60528 Q96DY4 HD5
Symbols HD5
NY-CO-9

Gene

PANTHER Protein Class (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651915 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC5

Gene RIF (46)

PMID Text
26747087 HDAC5 and HDAC6 were highly expressed in melanoma cells but exhibited low expression levels in normal skin cells.
26261519 Formononetin-combined therapy may enhance the therapeutic efficacy of doxorubicin in glioma cells by preventing EMT through inhibition of HDAC5.
26059794 These results suggest a strong regulatory function of HDAC5 in the pro-inflammatory response of macrophages.
25129440 mRNA and protein levels of HDAC5 were up-regulated in human hepatocellular carcinoma.
25096223 Data reveal a novel role of HDAC5 in modulating the KLF2 transcriptional activation and eNOS expression.
24920159 Studied phosphorylation sites within functional HDAC5 domains, including the deacetylation domain (DAC, Ser755), nuclear export signal (NES, Ser1108), and an acidic domain (AD, Ser611).
24732133 In C2C12 myoblasts, recombinant human HDAC5 phosphorylation by PKD regulated the expression of diverse metabolic genes and glucose metabolism.
24706304 HDAC5 promoted the Six1 expression.
24594363 In erythroid cells, pull down experiments identified the presence of a novel complex formed by HDAC5, GATA1, EKLF and pERK which was instead undetectable in cells of the megakaryocytic lineage.
24191246 we show that Stat3 binds to the promoter region of PTPN13 and promotes its activity through recruiting HDAC5. Thus, our results suggest a previously unknown Stat3-PTPN13 molecular network controlling squamous cell lung carcinoma development
More...

AA Sequence

MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDPT      1 - 70
LREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLAAKQQQEMLAAKRQQE     71 - 140
LEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQH    141 - 210
PKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSP    211 - 280
LLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHR    281 - 350
ALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST    351 - 420
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRH    421 - 490
RPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEELTEQQ    491 - 560
EVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEEDCIQVKDEEGESGAEEGPDLEEPGAGYKKLF    561 - 630
SDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGN    631 - 700
THVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGP    701 - 770
ISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM    771 - 840
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEV    841 - 910
GGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGGYSVTA    911 - 980
RCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVLQQKPNINAVATLEKV    981 - 1050
IEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEP   1051 - 1120
AL                                                                       1121 - 1122
//

Text Mined References (84)

PMID Year Title
26747087 2016 Both HDAC5 and HDAC6 are required for the proliferation and metastasis of melanoma cells.
26261519 2015 Formononetin sensitizes glioma cells to doxorubicin through preventing EMT via inhibition of histone deacetylase 5.
26059794 2015 Histone deacetylase 5 regulates the inflammatory response of macrophages.
25129440 2014 Down-regulation of HDAC5 inhibits growth of human hepatocellular carcinoma by induction of apoptosis and cell cycle arrest.
25096223 2014 Histone deacetylase 5 interacts with Krüppel-like factor 2 and inhibits its transcriptional activity in endothelium.
24920159 2014 Probing phosphorylation-dependent protein interactions within functional domains of histone deacetylase 5 (HDAC5).
24732133 2014 Compensatory regulation of HDAC5 in muscle maintains metabolic adaptive responses and metabolism in response to energetic stress.
24706304 2014 HDAC5 promotes cell proliferation in human hepatocellular carcinoma by up-regulating Six1 expression.
24594363 2014 Identification of NuRSERY, a new functional HDAC complex composed by HDAC5, GATA1, EKLF and pERK present in human erythroid cells.
24413532 2014 Differential regulation of estrogen receptor ? expression in breast cancer cells by metastasis-associated protein 1.
More...