Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
R01 Count 5
Funding $533,182.73
PubMed Score 288.01
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25846879 PPP1R3C, a novel hypermethylated gene in colorectal cancer, may play a critical role in cancer cell growth in association with glucose levels.
24861485 detection of methylation of PPP1R3C alone or in combination with EFHD1 in plasma DNA showed high sensitivity and specificity in CRC detection, and may be useful detection method for CRC, especially for early-stage CRCs.
21738631 Findings suggest that variations in PTG may condition the course of Lafora disease and establish PTG as a potential target for pharmacogenetic and therapeutic approaches.
20888814 Results demonstrated that HIF1 promotes glycogen accumulation through regulating PPP1R3C expression under hypoxia, which revealed a novel metabolic adaptation of cells to hypoxia.
19171932 phosphorylation of R5/PTG at Ser-8 by AMPK accelerates its laforin/malin-dependent ubiquitination and subsequent proteasomal degradation, which results in a decrease of its glycogenic activity.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKS      1 - 70
QNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQ     71 - 140
PSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGG    141 - 210
TDSDTFSFAIDLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQT    211 - 280
SPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR                                     281 - 317
//

Text Mined References (24)

PMID Year Title
26519772 2015 Role of glycogen phosphorylase in liver glycogen metabolism.
25846879 2015 The effect of high glucose levels on the hypermethylation of protein phosphatase 1 regulatory subunit 3C (PPP1R3C) gene in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24861485 2014 Aberrant promoter methylation of PPP1R3C and EFHD1 in plasma of colorectal cancer patients.
21738631 2011 A PTG variant contributes to a milder phenotype in Lafora disease.
20888814 2010 Hypoxia-inducible factor 1-mediated regulation of PPP1R3C promotes glycogen accumulation in human MCF-7 cells under hypoxia.
19171932 2009 AMP-activated protein kinase phosphorylates R5/PTG, the glycogen targeting subunit of the R5/PTG-protein phosphatase 1 holoenzyme, and accelerates its down-regulation by the laforin-malin complex.
18070875 2008 Malin decreases glycogen accumulation by promoting the degradation of protein targeting to glycogen (PTG).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...