Property Summary

NCBI Gene PubMed Count 78
PubMed Score 3712.13
PubTator Score 47.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.702 0.000
medulloblastoma, large-cell 1.100 0.000
diabetes mellitus 1.200 0.001

Synonym

Accession Q9UQF0 B2RPD4 O95244 O95245 Q8NHY7 Q9NRZ2 Q9NZG3
Symbols ENV
ENVW
HERVW
ERVWE1
HERV7Q
HERV-7q
HERVWENV
HERV-W-ENV

Gene

PANTHER Protein Class (2)

Gene RIF (58)

PMID Text
25651508 The effect of ETS1 on syncytialization of trophoblasts likely results, at least in part, from inhibition of syncytin expression.
25340371 Positive associations were observed between HERV-w methylation and dietary intakes of beta-carotene and carotenoids in a population of obese subjects.
25250834 HIV-1 Tat-mediated regulation of MSRV and Syncytin-1 involves TLR-4 in primary astrocytes
24814867 Data show that Multiple Sclerosis-Associated Retrovirus (MSRV) is predominantly expressed over ERWVE1 in astrocyte-derived U-87 glioblastoma cell line.
24812088 Exosomes from cultured primary villous cytotrophoblasts and sera of pregnant women have syncytin-1 on their surfaces. It acts on cellular binding and uptake of exosomes.
24687878 Syncytin-1 and ASCT-2 is localized at the acrosomal region and equatorial segment of the spermatozoa.
24478419 Influenza A virus infection transactivated ERVWE1 by increasing the transcription of GCM1.
24413738 Increased trophoblast apoptosis and altered expression levels of syncytin-1, calpain 1, and AIF is observed in preeclamptic placentas.
24204983 Insertionally polymorphic HERV-K113 and HERV-K115 are not associated with HIV infections.
24013223 Syncytin-1 overexpression may be an indicator of urothelial cell carcinoma risk.
More...

AA Sequence

MALPYHIFLFTVLLPSFTLTAPPPCRCMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPR      1 - 70
NCYHSATLCMHANTHYWTGKMINPSCPGGLGVTVCWTYFTQTGMSDGGGVQDQAREKHVKEVISQLTRVH     71 - 140
GTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFS    141 - 210
TEINTTSVLVGPLVSNLEITHTSNLTCVKFSNTTYTTNSQCIRWVTPPTQIVCLPSGIFFVCGTSAYRCL    211 - 280
NGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKL    281 - 350
SQELNGDMERVADSLVTLQDQLNSLAAVVLQNRRALDLLTAERGGTCLFLGEECCYYVNQSGIVTEKVKE    351 - 420
IRDRIQRRAEELRNTGPWGLLSQWMPWILPFLGPLAAIILLLLFGPCIFNLLVNFVSSRIEAVKLQMEPK    421 - 490
MQSKTKIYRRPLDRPASPRSDVNDIKGTPPEEISAAQPLLRPNSAGSS                          491 - 538
//

Text Mined References (79)

PMID Year Title
27486264 2016 The role of syncytins in human reproduction and reproductive organ cancers.
25651508 2015 ETS1 induces human trophoblast differentiation.
25340371 2014 Nutrients intake is associated with DNA methylation of candidate inflammatory genes in a population of obese subjects.
24814867 A peptide nucleic acid (PNA)-mediated polymerase chain reaction clamping allows the selective inhibition of the ERVWE1 gene amplification.
24812088 2014 Syncytin proteins incorporated in placenta exosomes are important for cell uptake and show variation in abundance in serum exosomes from patients with preeclampsia.
24687878 2014 Syncytin-1 and its receptor is present in human gametes.
24478419 2014 Transcriptional derepression of the ERVWE1 locus following influenza A virus infection.
24413738 2014 Reduced syncytin-1 expression in choriocarcinoma BeWo cells activates the calpain1-AIF-mediated apoptosis, implication for preeclampsia.
24204983 2013 Frequency of human endogenous retroviral sequences (HERV) K113 and K115 in the Polish population, and their effect on HIV infection.
24098463 2013 Expression of human endogenous retrovirus-w including syncytin-1 in cutaneous T-cell lymphoma.
More...