Property Summary

Ligand Count 20
NCBI Gene PubMed Count 54
PubMed Score 340.66
PubTator Score 115.06

Knowledge Summary

Patent (17,384)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 1.7
Disease Target Count Z-score Confidence
Dystonia 164 3.578 1.8

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
astrocytic glioma -1.500 1.8e-03
Astrocytoma, Pilocytic -1.400 1.4e-06
atypical teratoid / rhabdoid tumor -1.200 2.7e-06
ependymoma -1.900 4.4e-03
glioblastoma -1.300 2.1e-09
group 3 medulloblastoma -1.300 6.9e-03
intraductal papillary-mucinous adenoma (... 1.800 2.0e-03
lung carcinoma 3.100 7.6e-55
malignant mesothelioma -2.700 1.7e-06
medulloblastoma, large-cell -2.800 1.2e-07
oligodendroglioma -1.200 2.0e-02
primary pancreatic ductal adenocarcinoma -1.015 3.6e-02
primitive neuroectodermal tumor -1.100 8.7e-04
psoriasis -1.500 3.3e-03
subependymal giant cell astrocytoma -2.140 4.3e-02

Gene RIF (40)

AA Sequence

MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYG      1 - 70
DIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMC     71 - 140
TILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYITEF    141 - 210
VNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNK    211 - 280
CVVWPINFNESYLENGTKGFDWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGY    281 - 350
TSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA    351 - 420
TLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKE    421 - 490
RRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHN    491 - 560
SKSSIFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIF    561 - 630
PSLRRSVKRNSTVDCNGVVSLIGGPGSHIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSI    631 - 700
MSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFM    701 - 770
AMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGL    771 - 840
SVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQ    841 - 910
DCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSF    911 - 980
SADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTG    981 - 1050
ADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPE   1051 - 1120
GSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKT   1121 - 1190
CFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFF   1191 - 1260
TNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNV   1261 - 1330
LLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNTEIRWKNVKINFDNVG   1331 - 1400
AGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQ   1401 - 1470
KKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMM   1471 - 1540
VETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYF   1541 - 1610
VSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEA   1611 - 1680
GIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYI   1681 - 1750
IISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLR   1751 - 1820
VPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTL   1821 - 1890
RRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVTKPEKEKQQR   1891 - 1960
AEEGRRERAKRQKEVRESKC                                                     1961 - 1980
//

Text Mined References (61)

PMID Year Title