Property Summary

NCBI Gene PubMed Count 41
Grant Count 8
R01 Count 6
Funding $539,911.68
PubMed Score 96.69
PubTator Score 58.76

Knowledge Summary

Patent (6,478)

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis 1.500 0.000

Synonym

Accession Q9UQB9 O60681 O75442 Q6AZY8 Q6DLZ0 Q9UPK5
Symbols AIE2
AIK3
ARK3
AurC
SPGF5
STK13
HEL-S-90
aurora-C

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (34)

PMID Text
26341096 Homozygous c.144delC mutation in AURKC gene in infertile men with macrozoospermia in the Tunisian population
26118178 may play an important role in the development of colorectal cancer
25994570 Overexpression of AURKC is associated with breast tumors.
25990457 Low AURKC expression is associated with cancer.
25369539 Data indicate that the selective Aurora A, B, and C inhibitor SAR156497 showed antineoplastic activity in HCT116 cell xenograft model.
25219909 AURKC mutations are more frequent than Klinefelter syndrome and constitute the leading genetic cause of infertility in North African men.
24632603 This review will describe the functions of each Aurora kinase which include Aurora A (AURKA), Aurora B (AURKB) and Aurora C (AURKC summarize their involvement in leukemia and discuss inhibitor development and efficacy in leukemia clinical trials
24603334 Aberrantly expressed Aurora-C in somatic cancer cells may impair spindle checkpoint assembly by displacing the centromeric localization of chromosomal passenger complexes.
24484996 Our data indicate that the AURKC c.144delC mutation has a relatively high carrier frequency in the Moroccan population.
23581231 Here we provide evidence for the first time of Aurora-C overexpression and gene amplification.
More...

AA Sequence

MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVA      1 - 70
LKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDE     71 - 140
QRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEM    141 - 210
IEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLE    211 - 280
RLPLAQILKHPWVQAHSRRVLPPCAQMAS                                             281 - 309
//

Text Mined References (43)

PMID Year Title
26341096 2015 Macrozoospermia: screening for the homozygous c.144delC mutation in AURKC gene in infertile men and estimation of its heterozygosity frequency in the Tunisian population.
26118178 2015 Expression Analysis of Aurora-C and Survivin, Two Testis-Specific Genes, in Patients with Colorectal Cancer.
25994570 2015 Transcriptome analysis of the cancer/testis genes, DAZ1, AURKC, and TEX101, in breast tumors and six breast cancer cell lines.
25990457 2015 Regulation of AURKC expression by CpG island methylation in human cancer cells.
25369539 2015 SAR156497, an exquisitely selective inhibitor of aurora kinases.
25219909 Mutations of the aurora kinase C gene causing macrozoospermia are the most frequent genetic cause of male infertility in Algerian men.
24632603 2015 The aurora kinases in cell cycle and leukemia.
24603334 2014 Overexpression of Aurora-C interferes with the spindle checkpoint by promoting the degradation of Aurora-B.
24484996 2014 Prevalence of the Aurora kinase C c.144delC mutation in infertile Moroccan men.
23581231 2012 Gene amplification and overexpression of Aurora-C in breast and prostate cancer cell lines.
More...