Property Summary

Ligand Count 26
NCBI Gene PubMed Count 44
PubMed Score 103.56
PubTator Score 58.76

Knowledge Summary

Patent (6,478)

Expression

  Differential Expression (1)

Disease log2 FC p
cystic fibrosis 1.500 3.5e-04

Gene RIF (36)

AA Sequence

MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVA      1 - 70
LKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDE     71 - 140
QRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEM    141 - 210
IEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLE    211 - 280
RLPLAQILKHPWVQAHSRRVLPPCAQMAS                                             281 - 309
//

Text Mined References (46)

PMID Year Title