Property Summary

NCBI Gene PubMed Count 55
Grant Count 27
R01 Count 19
Funding $1,858,710.7
PubMed Score 92.21
PubTator Score 34.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
25839933 Study describes two Ion-syndromic intellectual disability cases, positive for the presence of a small copy number variants, intragenic CTNND2 gene deletion.
25473103 the effect of CTNND2 polymorphisms on normal variability and identified a polymorphism (rs2561622) with significant effect on phonological ability and white matter volume in the left frontal lobe, was investigated.
25120748 co-expression of Delta-catenin and RhoA was significantly associated with histological type, differentiation, pTNM stage, lymphatic metastasis and a poor prognosis in non-small cell lung cancer
25090917 our results suggest that delta-catenin acts as an oncoprotein when overexpressed in esophageal squamous cell carcinoma
24727894 Results conclude that the introduction of CTNND2 gene variation is an important milestone in prostate cancer metabolic adaptation.
24256404 SNPs in CTNND2 showed an increased signal for schizophrenia and major depressive disorder, but not for bipolar disorder. The association between CTNND2 and anxiety was not strong enough in current generation of human genome-wide analyses.
22984439 Genome-wide significant association with CTNND2 single nucleotide polymorphisms rs17183619, rs13155993 and rs13170756 for the bivariate outcome of cortical cataract and temporal horn volume, is reported.
22759899 Specific polymorphisms in the CTNND2 gene and 11q24.1 genomic region were found to be significantly associated with pathological myopia in this Chinese population.
22213037 delta-catenin upregulates the activity of cdc42 and Rac1 GTPases at transcriptional level, and their coexpression predict a poor clinical outcome in nonsmall cell lung cancer patients
21911587 These results confirmed the strong association between CTNND2 polymorphism and myopia.
More...

AA Sequence

MFARKPPGAAPLGAMPVPDQPSSASEKTSSLSPGLNTSNGDGSETETTSAILASVKEQELQFERLTRELE      1 - 70
AERQIVASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTGLELVDSCIRSLQESGILDPQ     71 - 140
DYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLALGETTPSQLPARGTQARATGQSFSQGTTSRA    141 - 210
GHLAGPEPAPPPPPPPREPFAPSLGSAFHLPDAPPAAAAAALYYSSSTLPAPPRGGSPLAAPQGGSPTKL    211 - 280
QRGGSAPEGATYAAPRGSSPKQSPSRLAKSYSTSSPINIVVSSAGLSPIRVTSPPTVQSTISSSPIHQLS    281 - 350
STIGTYATLSPTKRLVHASEQYSKHSQELYATATLQRPGSLAAGSRASYSSQHGHLGPELRALQSPEHHI    351 - 420
DPIYEDRVYQKPPMRSLSQSQGDPLPPAHTGTYRTSTAPSSPGVDSVPLQRTGSQHGPQNAAAATFQRAS    421 - 490
YAAGPASNYADPYRQLQYCPSVESPYSKSGPALPPEGTLARSPSIDSIQKDPREFGWRDPELPEVIQMLQ    491 - 560
HQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKI    561 - 630
ALKNCGGIPALVRLLRKTTDLEIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQD    631 - 700
DRKIQLHSSQVLRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRN    701 - 770
LSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQM    771 - 840
LWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKWSVYIRAAVRKEKGLPILVELLRIDNDRVVC    841 - 910
AVATALRNMALDVRNKELIGKYAMRDLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKA    911 - 980
LRDAGGIEKLVGISKSKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIERDRQRP    981 - 1050
YSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGI   1051 - 1120
STLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG   1121 - 1190
LKSTGNYVDFYSAARPYSELNYETSHYPASPDSWV                                      1191 - 1225
//

Text Mined References (57)

PMID Year Title
25839933 2015 CTNND2 deletion and intellectual disability.
25807484 2015 Loss of ?-catenin function in severe autism.
25473103 2015 CTNND2-a candidate gene for reading problems and mild intellectual disability.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25120748 2014 Co-expression of delta-catenin and RhoA is significantly associated with a malignant lung cancer phenotype.
25090917 2014 The expression of ?-catenin in esophageal squamous cell carcinoma and its correlations with prognosis of patients.
24727894 2015 ?-Catenin, a Wnt/?-catenin modulator, reveals inducible mutagenesis promoting cancer cell survival adaptation and metabolic reprogramming.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24256404 2014 Further confirmation of the association between anxiety and CTNND2: replication in humans.
More...