Property Summary

NCBI Gene PubMed Count 52
PubMed Score 647.50
PubTator Score 139.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Paraplegia 74 6.085 3.0
SPASTIC PARAPLEGIA 7, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count
16q24.3 microdeletion syndrome 6

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.200 1.4e-02
astrocytic glioma 1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.600 1.6e-03
ependymoma 1.600 2.0e-03
glioblastoma -1.800 3.8e-04
group 4 medulloblastoma -1.400 3.3e-02
intraductal papillary-mucinous adenoma (... 1.100 3.7e-03
intraductal papillary-mucinous carcinoma... 1.100 8.7e-03
medulloblastoma, large-cell -2.200 2.4e-05
oligodendroglioma 1.800 5.8e-04
osteosarcoma 1.002 8.4e-03
ovarian cancer -1.300 1.5e-05
Pick disease -1.300 9.2e-06

Gene RIF (30)

AA Sequence

MAVLLLLLRALRRGPGPGPRPLWGPGPAWSPGFPARPGRGRPYMASRPPGDLAEAGGRALQSLQLRLLTP      1 - 70
TFEGINGLLLKQHLVQNPVRLWQLLGGTFYFNTSRLKQKNKEKDKSKGKAPEEDEEERRRRERDDQMYRE     71 - 140
RLRTLLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLHPGAVVFGRPRLAL    141 - 210
MYRMQVANIDKFEEKLRAAEDELNIEAKDRIPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGR    211 - 280
EGGFSAFNQLKMARFTIVDGKMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGP    281 - 350
PGCGKTLLAKAVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTT    351 - 420
MSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQERREIFE    421 - 490
QHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSVHTLNFEYAVERVLAGTAKKS    491 - 560
KILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRTNAALGFAQMLPRDQHLFTKEQLFERMCMAL    561 - 630
GGRASEALSFNEVTSGAQDDLRKVTRIAYSMVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMD    631 - 700
HEARLLVAKAYRHTEKVLQDNLDKLQALANALLEKEVINYEDIEALIGPPPHGPKKMIAPQRWIDAQREK    701 - 770
QDLGEEETEETQQPPLGGEEPTWPK                                                 771 - 795
//

Text Mined References (52)

PMID Year Title