Property Summary

NCBI Gene PubMed Count 39
Grant Count 17
R01 Count 16
Funding $797,118.26
PubMed Score 49.02
PubTator Score 25.45

Knowledge Summary

Patent (19,185)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
19520772 study identified p21 activated kinase 1 (PAK1) as a new CDK11(p58) substrate; mapped a new phosphorylation site of Ser174 on PAK1; results indicated PAK1 may serve as a downstream effector of CDK11(p58) during mitosis progression
19245811 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
19122208 These data identified a new negative regulatory protein of ERalpha and provided a new pathway by which CDK11(p58) negatively regulated cells.
17606997 findings show that, in addition to playing a role in spindle formation and structure, CDK11(p58) is also required for sister chromatid cohesion and the completion of mitosis
17177267 Observational study of gene-disease association. (HuGE Navigator)
17177267 CDC2L2 gene may contribute to the susceptibility of type 2 diabetes in the northern Han Chinese population.
16462731 mitotic CDK11(p58) isoform, but not the CDK11(p110) isoform, associates with mitotic centrosomes
16039607 These findings suggest that CDK11 may contribute to apoptosis by regulating the activity of NOT2 independent of its kinase activity.
16004605 CDK11p60 can contribute to apoptosis by direct signalling at the mitochondria, thereby amplifying Fas-induced apoptosis in melanoma cells.
More...

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEITIRNSPYRRE      1 - 70
DSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHERRKRHREEQDKARREWERQK     71 - 140
RREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDY    141 - 210
SDKVKASHWSRSPPRPPRERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSA    211 - 280
ESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEE    281 - 350
RENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGC    351 - 420
RSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVRE    421 - 490
IVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSH    491 - 560
AGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS    561 - 630
EIDQINKVFKELGTPSEKIWPGYSELPVVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRI    631 - 700
SAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQ    701 - 770
GASAAGPGFSLKF                                                             771 - 783
//

Text Mined References (40)

PMID Year Title
23178491 2014 CHK2 kinase promotes pre-mRNA splicing via phosphorylating CDK11(p110).
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19520772 2009 CDK11p58 phosphorylation of PAK1 Ser174 promotes DLC2 binding and roles on cell cycle progression.
19245811 2009 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
19122208 2009 Repression of estrogen receptor alpha by CDK11p58 through promoting its ubiquitin-proteasome degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17606997 2007 CDK11(p58) is required for the maintenance of sister chromatid cohesion.
17177267 2007 Genetic variations of the CDC2L2 gene are associated with type 2 diabetes in a Han Chinese cohort.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...