Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.22
PubTator Score 1.31

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22748001 recurrent deletions that may confer risk for preeclampsia include a potentially functionally important copy-number deletion in the PSG11 gene.

AA Sequence

MGPLSAPPCTEHIKWKGLLLTALLLNFWNLPTTAQVMIEAQPPKVSEGKDVLLLVHNLPQNLTGYIWYKG      1 - 70
QIRDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDGTRGVTGYFTF     71 - 140
TLYLETPKPSISSSNLNPREAMETVILTCNPETPDASYLWWMNGQSLPMTHRMQLSETNRTLFLFGVTKY    141 - 210
TAGPYECEIWNSGSASRSDPVTLNLLHGPDLPRIFPSVTSYYSGENLDLSCFANSNPPAQYSWTINGKFQ    211 - 280
LSGQKLFIPQITPKHNGLYACSARNSATGEESSTSLTIRVIAPPGLGTFAFNNPT                   281 - 335
//

Text Mined References (10)

PMID Year Title
22748001 2012 Genome-wide association study identifies a maternal copy-number deletion in PSG11 enriched among preeclampsia patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
1840485 1991 Cloning and expression of a new pregnancy-specific beta 1-glycoprotein member.
1690992 1990 The human pregnancy-specific glycoprotein genes are tightly linked on the long arm of chromosome 19 and are coordinately expressed.