Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.86
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ulcerative colitis 1819 3.7e-08
psoriasis 6694 5.9e-05
primary pancreatic ductal adenocarcinoma 1109 8.1e-03
active Crohn's disease 922 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.188 1.9e-02
primary pancreatic ductal adenocarcinoma 1.129 8.1e-03
psoriasis 1.700 5.9e-05
ulcerative colitis -1.300 3.7e-08

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDE      1 - 70
IKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRT     71 - 140
GVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVIVVLIAETDSQYTSAVTENIKALFPTEIHSG    141 - 210
LLEVISPSPHFYPDFSRLRESFGDPKERVRWRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTM    211 - 280
KNFALQQPSEDWMILEFSQLGFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHC    281 - 350
DRQKANLRIRFKPSLFQHVGTHSSLAGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYL    351 - 420
REDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTAT    421 - 490
LRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILSEIFLKKAD                491 - 548
//

Text Mined References (15)

PMID Year Title