Property Summary

NCBI Gene PubMed Count 23
PubMed Score 109.63
PubTator Score 15.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 1.5e-04
atypical teratoid/rhabdoid tumor -1.200 3.1e-05
ependymoma -1.400 6.5e-17
glioblastoma -1.200 1.5e-08
group 3 medulloblastoma -1.300 3.4e-04
lung adenocarcinoma -2.100 3.1e-17
lung cancer -1.100 8.3e-04
lung carcinoma -2.300 6.1e-21
medulloblastoma, large-cell -1.100 4.2e-04
non-small cell lung cancer -1.042 1.0e-15
pituitary cancer 1.500 3.4e-03
psoriasis -1.800 1.2e-15

Gene RIF (7)

AA Sequence

MRLLWKLVILLPLINSSAGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDID      1 - 70
FTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAYIEDFETKTRSTVSVREGQGV     71 - 140
VLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGNLYIAKVEPSDVGNYTCFITNKEAQRSVQGP    141 - 210
PTPLVQRTDGVMGEYEPKIEVRFPETIQAAKDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQA    211 - 280
ILEIPNFQQEDEGFYECIASNLRGRNLAKGQLIFYAPPEWEQKIQNTHLSIYDNLLWECKASGKPNPWYT    281 - 350
WLKNGERLNPEERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSF    351 - 420
VQVGGDIVIGCKPNAFPRAAISWKRGTETLRQSKRIFLLEDGSLKIYNITRSDAGSYTCIATNQFGTAKN    421 - 490
TGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGDVIDLKKGVAHFERIGGESVG    491 - 560
DLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGPPEDVQVEDISSTTSQLSWRAGPDNNSPIQI    561 - 630
FTIQTRTPFSVGWQAVATVPEILNGKTYNATVVGLSPWVEYEFRVVAGNSIGIGEPSEPSELLRTKASVP    631 - 700
VVAPVNIHGGGGSRSELVITWESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIP    701 - 770
LSPFEVKVGVYNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEV    771 - 840
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKKSPPSQPPANI    841 - 910
AWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSAELLVPFEEDYLIEIRTVSDG    911 - 980
GDGSSSEEIRIPKMSSLSSRGIQFLEPSTHFLSIVIVIFHCFAIQPLI                          981 - 1028
//

Text Mined References (27)

PMID Year Title