Property Summary

NCBI Gene PubMed Count 44
Grant Count 4
R01 Count 4
Funding $455,058.25
PubMed Score 109.37
PubTator Score 72.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.474 0.000

Synonym

Accession Q9UQ49 A8K327 Q9NQE1
Symbols SIAL3

Gene

PANTHER Protein Class (1)

Gene RIF (39)

PMID Text
26470851 findings identify NEU3 as a participant in head and neck squamous cell carcinoma progression
26251452 In the plasma membrane, NEU3 has a role in endocytosis and protein binding at the cell surface.
25922362 Besides the already reported indirect EGFR activation through GM3, sialidase NEU3 could also play a role on EGFR activation through its desialylation.
25810027 Results indicate an essential contribution of NEU3 to tumorigenic potential through maintenance of stem-like characteristics of colon cancer cells by regulating Wnt signaling at the receptor level.
25803810 NEU3 promotes anchorage-independent growth and in vivo tumorigenicity.
25652216 The results provide strong evidence that the serum sialidase is, in fact, NEU3, and this subtype may, therefore, be a potential utility for novel diagnosis of human cancers
25408341 Studies indicate that ganglioside-specific sialidase NEU3 cleaves sialic acids preferentially from gangliosides.
23139422 NEU3 is a key regulator of the beta1 integrin-recycling pathway and FAK/AKT signaling and demonstrate its crucial role in renal cell carcinomas malignancy.
22989879 Data indicate that sialidases Neu1 and Neu3 are present on sperm, and their activity is required for capacitation and zona pellucida binding.
22903576 Weak anchorage of NEU1 and NEU3 to the plasma membrane and their loss during erythrocyte life could be a tool to preserve the cellular sialic acid content to avoid early aging of erythrocyte and processes of cell aggregation in the capillaries.
More...

AA Sequence

MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQW      1 - 70
GPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSE     71 - 140
VRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGV    141 - 210
TWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQ    211 - 280
GSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQT    281 - 350
PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGR    351 - 420
NPSQFKSN                                                                  421 - 428
//

Text Mined References (48)

PMID Year Title
26470851 2015 Upregulation of sialidase NEU3 in head and neck squamous cell carcinoma associated with lymph node metastasis.
26251452 2015 Role of plasma-membrane-bound sialidase NEU3 in clathrin-mediated endocytosis.
25922362 2015 NEU3 activity enhances EGFR activation without affecting EGFR expression and acts on its sialylation levels.
25810027 2015 Sialidase NEU3 contributes neoplastic potential on colon cancer cells as a key modulator of gangliosides by regulating Wnt signaling.
25803810 2015 Potentiation of epidermal growth factor-mediated oncogenic transformation by sialidase NEU3 leading to Src activation.
25652216 2015 Increased sialidase activity in serum of cancer patients: Identification of sialidase and inhibitor activities in human serum.
25408341 2015 Plasma membrane-associated sialidase confers cancer initiation, promotion and progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139422 2012 The plasma membrane sialidase NEU3 regulates the malignancy of renal carcinoma cells by controlling ?1 integrin internalization and recycling.
22989879 2012 Sialidases on mammalian sperm mediate deciduous sialylation during capacitation.
More...