Property Summary

NCBI Gene PubMed Count 47
PubMed Score 118.21
PubTator Score 72.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.474 1.9e-06

Gene RIF (41)

AA Sequence

MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQW      1 - 70
GPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSGRNAARLCFIYSQDAGCSWSE     71 - 140
VRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGV    141 - 210
TWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQ    211 - 280
GSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQT    281 - 350
PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGR    351 - 420
NPSQFKSN                                                                  421 - 428
//

Text Mined References (51)

PMID Year Title