Property Summary

NCBI Gene PubMed Count 45
PubMed Score 21.89
PubTator Score 21.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
non-small cell lung carcinoma 413 2.06446444821306E-30
lung adenocarcinoma 2714 1.41213668111388E-15
ependymoma 2514 3.13879963556348E-13
atypical teratoid/rhabdoid tumor 1095 1.94505188047941E-12
lung carcinoma 2844 6.96580586232653E-12
medulloblastoma, large-cell 6234 1.26649527061075E-7
sonic hedgehog group medulloblastoma 1482 2.32766695753017E-7
pituitary cancer 1972 6.3983308197089E-7
pediatric high grade glioma 2712 1.43538289869309E-6
pilocytic astrocytoma 3086 1.50050787683764E-5
glioblastoma 5572 3.73101358482888E-5
Pick disease 1893 9.37820281657681E-4
tuberculosis 1563 0.00105918819909266
primitive neuroectodermal tumor 3031 0.00149865729861245
pancreatic carcinoma 567 0.00260139794028584
pancreatic cancer 2300 0.00260139794028586
lung cancer 4473 0.00408439744931734
gastric cancer 436 0.00600403243202523
active ulcerative colitis 477 0.021943016445378
active Crohn's disease 918 0.0263333142078511
osteosarcoma 7933 0.0334537440860556
astrocytoma 1493 0.0404936190293807
Alzheimer's disease 644 0.0416750609272922
subependymal giant cell astrocytoma 2287 0.0455847570617504
ovarian cancer 8492 0.0468251432109826
progressive supranuclear palsy 674 0.0487298240727202
Disease Target Count Z-score Confidence
Brachydactyly 52 3.707 1.9

Expression

  Differential Expression (26)

Disease log2 FC p
gastric cancer 1.200 0.006
pancreatic cancer 1.200 0.003
astrocytoma -2.500 0.040
ependymoma -3.700 0.000
glioblastoma -3.300 0.000
osteosarcoma -1.433 0.033
sonic hedgehog group medulloblastoma -4.000 0.000
atypical teratoid/rhabdoid tumor -5.000 0.000
medulloblastoma, large-cell -4.800 0.000
primitive neuroectodermal tumor -2.100 0.001
tuberculosis 1.200 0.001
lung cancer -1.900 0.004
active Crohn's disease 1.422 0.026
active ulcerative colitis 1.888 0.022
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -1.700 0.000
pancreatic carcinoma 1.200 0.003
subependymal giant cell astrocytoma -3.039 0.046
lung carcinoma -1.100 0.000
non-small cell lung carcinoma -1.300 0.000
Alzheimer's disease -1.100 0.042
Pick disease -2.100 0.001
progressive supranuclear palsy -1.200 0.049
ovarian cancer 1.100 0.047
pituitary cancer 1.600 0.000

Synonym

Gene

PDB

3L43   5A3F  

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (17)

PMID Text
26784388 DNM3 attenuates the proliferation and induces apoptosis of gastric cancer cells.
26333682 Microdeletion of DNM3 harboring miR199 and miR214 is associated with skeletal abnormalities.
25496667 Knockdown of DNM3 by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
24673776 Data show that the classical dynamin DNM1 and DNM3 genes reach their maximum expression levels (100% of maximal expression) in all normal central nervous system tissues studied.
23170932 Dynamin-dependent endocytosis is required for intracellular accumulation of HIV-1 Gag in the presence of HLA-DR
22972982 Data indicate that dynamin 3 (DNM3) harbors MEIS1 binding sites and is associated with differences in mean platelet volume (MPV).
22846998 Dynamin-dependent endocytosis is required for intracellular accumulation of HIV-1 Gag in the presence of HLA-DR
21671749 DNM3 not only participates in megakaryocyte progenitor amplification, but is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20700106 Dynamin GTPase regulation is altered by PH domain mutations found in centronuclear myopathy patients.
More...

AA Sequence

MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLV      1 - 70
LQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGI     71 - 140
TKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKV    211 - 280
LNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQ    281 - 350
VDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL    351 - 420
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNH    421 - 490
EDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYK    491 - 560
DDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLELACDSQEDVDSWKASLLRAG    561 - 630
VYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSE    631 - 700
LLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSP    701 - 770
PPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR    771 - 840
APPSVPSRRPPPSPTRPTIIRPLESSLLD                                             841 - 869
//

Text Mined References (46)

PMID Year Title
26784388 2016 DNM3 Attenuates Hepatocellular Carcinoma Growth by Activating P53.
26333682 2015 Two further patients with the 1q24 deletion syndrome expand the phenotype: A possible role for the miR199-214 cluster in the skeletal features of the condition.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24673776 2014 Classical dynamin DNM1 and DNM3 genes attain maximum expression in the normal human central nervous system.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22972982 2012 A GWAS sequence variant for platelet volume marks an alternative DNM3 promoter in megakaryocytes near a MEIS1 binding site.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
More...