Property Summary

NCBI Gene PubMed Count 48
PubMed Score 22.65
PubTator Score 21.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.422 2.6e-02
active ulcerative colitis 1.888 2.2e-02
adult high grade glioma -2.800 3.1e-08
Alzheimer's disease -1.100 4.2e-02
astrocytic glioma -1.500 2.6e-02
Astrocytoma, Pilocytic -1.700 1.2e-05
atypical teratoid / rhabdoid tumor -4.800 9.7e-09
ependymoma -3.200 4.3e-02
gastric cancer 1.200 6.0e-03
glioblastoma -2.400 3.1e-06
group 3 medulloblastoma -3.200 1.3e-05
lung adenocarcinoma -1.300 1.4e-15
lung cancer -1.900 4.1e-03
lung carcinoma -1.100 7.0e-12
medulloblastoma, large-cell -1.200 1.9e-03
non-small cell lung carcinoma -1.300 2.1e-30
osteosarcoma -1.433 3.3e-02
ovarian cancer 1.100 4.7e-02
pancreatic cancer 1.200 2.6e-03
pancreatic carcinoma 1.200 2.6e-03
Pick disease -2.100 9.4e-04
pituitary cancer 1.300 1.7e-04
primitive neuroectodermal tumor -2.100 1.5e-03
progressive supranuclear palsy -1.200 4.9e-02
subependymal giant cell astrocytoma -3.039 4.6e-02
tuberculosis 1.200 1.1e-03

Protein-protein Interaction (11)

Gene RIF (20)

AA Sequence

MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLV      1 - 70
LQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPINLRVYSPHVLNLTLIDLPGI     71 - 140
TKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLM    141 - 210
DEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKV    211 - 280
LNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQ    281 - 350
VDTLELSGGAKINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL    351 - 420
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNH    421 - 490
EDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIMKGGSKGYWFVLTAESLSWYK    491 - 560
DDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQRNVYKDYRFLELACDSQEDVDSWKASLLRAG    561 - 630
VYPDKSVAENDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSE    631 - 700
LLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSP    701 - 770
PPSPTTQRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR    771 - 840
APPSVPSRRPPPSPTRPTIIRPLESSLLD                                             841 - 869
//

Text Mined References (49)

PMID Year Title