Property Summary

NCBI Gene PubMed Count 26
Grant Count 20
R01 Count 10
Funding $975,317.08
PubMed Score 50.06
PubTator Score 37.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.343 0.005
Multiple myeloma 1.221 0.016
medulloblastoma, large-cell -1.400 0.000
adult high grade glioma -1.100 0.001
ovarian cancer -1.400 0.001

Gene RIF (17)

PMID Text
26519477 results demonstrate that PSMC5 is a new and important player involved in regulating ERK1/2 signal transmission through the remodeling of Shoc2 scaffold complex in a spatially-defined manner.
25858597 Two unrelated Taiwanese patients have been described with Noonan-like syndrome with loose anagen hair who also have moyamoya disease and in whom heterozygous germline mutation in SHOC2 was found.
25514808 ectopic overexpression of human Shoc2 in PC12 cells significantly promotes neurite extension in the presence of Epidermal Growth Factor, a stimulus that induces proliferation rather than differentiation in these cells.
25331583 Extreme phenotypic variability associated with the invariant SHOC2 c.4A>G (p.Ser2Gly) missense mutation in Noonan-like syndrome with loose anagen hair.
25022756 Data show that both Shoc2 and HUWE1 are necessary to control the levels and ubiquitination of the Shoc2 signaling partner, RAF-1.
24458587 A newborn heterozygous for the invariant c.4A>G missense change in SHOC2.
24211266 Both MRAS and SHOC2 play a key role in polarized migration.
23076151 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
22995099 Noonan-like syndrome has been related to the invariant c.4A > G missense change in SHOC2.
22606262 targeting of Shoc2 to late endosomes may facilitate EGFR-induced ERK activation under physiological conditions of cell stimulation by EGF, and therefore, may be involved in the spatiotemporal regulation of signaling through the RAS-RAF module
More...

AA Sequence

MSSSLGKEKDSKEKDPKVPSAKEREKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDN      1 - 70
TIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPA     71 - 140
EVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKD    141 - 210
IKNLSKLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTI    211 - 280
GNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGG    281 - 350
PSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPED    351 - 420
VSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGI    421 - 490
GHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQI    491 - 560
VAGGPSFIIQFLKMQGPYRAMV                                                    561 - 582
//

Text Mined References (29)

PMID Year Title
26519477 2015 Spatial control of Shoc2-scaffold-mediated ERK1/2 signaling requires remodeling activity of the ATPase PSMC5.
25858597 2015 Moyamoya disease in two patients with Noonan-like syndrome with loose anagen hair.
25514808 2014 Shoc2/Sur8 protein regulates neurite outgrowth.
25331583 2014 Phenotypic variability associated with the invariant SHOC2 c.4A>G (p.Ser2Gly) missense mutation.
25137548 2014 A Novel SHOC2 Variant in Rasopathy.
25022756 2014 HUWE1 is a molecular link controlling RAF-1 activity supported by the Shoc2 scaffold.
24458587 2014 Hydrops fetalis in a preterm newborn heterozygous for the c.4A>G SHOC2 mutation.
24211266 2013 An MRAS, SHOC2, and SCRIB complex coordinates ERK pathway activation with polarity and tumorigenic growth.
23918763 2013 Expanding the SHOC2 mutation associated phenotype of Noonan syndrome with loose anagen hair: structural brain anomalies and myelofibrosis.
23076151 2012 SHOC2 and CRAF mediate ERK1/2 reactivation in mutant NRAS-mediated resistance to RAF inhibitor.
More...