Property Summary

NCBI Gene PubMed Count 22
PubMed Score 60.31
PubTator Score 67.18

Knowledge Summary

Patent (6,235)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 2 142 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Renal Cell Carcinoma 214 3.06 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.162 9.8e-03
cystic fibrosis 1.367 1.1e-04
ependymoma 1.600 2.2e-02
group 3 medulloblastoma 1.500 1.0e-04
malignant mesothelioma -5.500 3.5e-10
nasopharyngeal carcinoma -1.100 1.9e-07

Gene RIF (11)

AA Sequence

MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVV      1 - 70
FDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDV     71 - 140
LKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQ    141 - 210
ISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQAL    211 - 280
QHPYFQEQRKTEKRALGSHRKAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELP    281 - 350
KLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR     351 - 419
//

Text Mined References (24)

PMID Year Title