Property Summary

NCBI Gene PubMed Count 22
Grant Count 9
R01 Count 9
Funding $1,937,125.8
PubMed Score 55.96
PubTator Score 67.18

Knowledge Summary

Patent (6,235)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -5.500 0.000
posterior fossa group B ependymoma 1.800 0.000
cystic fibrosis 1.367 0.000
group 3 medulloblastoma 1.500 0.000
nasopharyngeal carcinoma -1.100 0.000
chronic rhinosinusitis -1.162 0.010

Gene RIF (11)

PMID Text
25755699 our results suggest MOK promoter hypomethylation is a common event and contributes to MOK overexpression in acute myeloid leukemia
24529564 The findings indicate a statistically significant association of p.Gly82Ser polymorphism in RAGE with DR in T2DM patients.
24244486 the expressions of ICK/MAK/MOK proteins in the intestinal tract can be differentially and dynamically regulated, implicating a significant functional diversity within this group of protein kinases.
21717246 Our results suggest that RAGE may be important in tumor invasion and could be a potential predictor for the prognosis of hepatocellular carcinoma patients.
21377387 PBMNC from type 2 diabetics were more sensitive to innate immune stimulation with LPS and monoclonal agonist anti-TLR4 than were cells from ND. The actions of LPS, anti-TLR4 and anti-RAGE potentiated the production of IL-6 and TNF-alpha in both groups.
21264954 The RAGE pathway may play an important role in STAT3 induction in glioma-associated macrophages and microglia, a process that may be mediated through S100B.
19060005 POLL is under genetic selection in Sub-Saharan African populations.
18685487 Compared RAGE and PAX-2 staining in metastatic clear renal cell carcinoma.
15900605 May provide suitable targets for immunotherapy of renal cell carcinoma.
15327990 identification of MOK, a member of the mitogen-activated protein kinase superfamily, as one of the genes induced by a caudal-related homeobox transcription factor, Cdx2
More...

AA Sequence

MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVV      1 - 70
FDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDV     71 - 140
LKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQ    141 - 210
ISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQAL    211 - 280
QHPYFQEQRKTEKRALGSHRKAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELP    281 - 350
KLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR     351 - 419
//

Text Mined References (24)

PMID Year Title
25755699 2015 MOK overexpression is associated with promoter hypomethylation in patients with acute myeloid leukemia.
24529564 2014 Association of RAGE (p.Gly82Ser) and MnSOD (p.Val16Ala) polymorphisms with diabetic retinopathy in T2DM patients from north India.
24244486 2013 Distinct expression patterns of ICK/MAK/MOK protein kinases in the intestine implicate functional diversity.
21717246 2012 Overexpression of renal tumor antigen is associated with tumor invasion and poor prognosis of hepatocellular carcinoma.
21377387 2011 TLR4 and RAGE: similar routes leading to inflammation in type 2 diabetic patients.
21264954 2011 S100B attenuates microglia activation in gliomas: possible role of STAT3 pathway.
19060005 2009 Targeted resequencing of two genes, RAGE and POLL, confirms findings from a genome-wide scan for adaptive evolution and provides evidence for positive selection in additional populations.
18685487 2008 The utility of PAX-2 in distinguishing metastatic clear cell renal cell carcinoma from its morphologic mimics: an immunohistochemical study with comparison to renal cell carcinoma marker.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17549666 Usefulness of CDK5RAP3, CCNB2, and RAGE genes for the diagnosis of lung adenocarcinoma.
More...