Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.33
PubTator Score 0.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.164 4.6e-02
adrenocortical carcinoma -1.246 1.6e-09
Astrocytoma, Pilocytic -2.000 1.9e-06
Atopic dermatitis -1.300 5.7e-04
atypical teratoid / rhabdoid tumor -2.800 2.3e-05
colon cancer -1.600 3.9e-02
cystic fibrosis 1.253 1.0e-04
ductal carcinoma in situ -1.800 6.0e-03
invasive ductal carcinoma -1.372 1.6e-03
lung cancer -1.500 1.7e-02
malignant mesothelioma -1.200 5.2e-05
medulloblastoma, large-cell -2.500 7.0e-04
non-small cell lung cancer -1.259 5.1e-14
ovarian cancer -1.700 1.0e-11
Pick disease -1.200 2.3e-03
psoriasis -1.500 5.7e-10

Gene RIF (1)

AA Sequence

MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPL      1 - 70
EQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRV     71 - 140
GLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPR    141 - 210
SGRVLQEANCKNHRVNRVVFLGNMKRLLTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDA    211 - 280
DTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLI    281 - 350
EPISMIVPRRSDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVV    351 - 420
VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC              421 - 480
//

Text Mined References (11)

PMID Year Title