Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.16
PubTator Score 0.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -2.000 0.000
cystic fibrosis 1.253 0.000
atypical teratoid/rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -2.500 0.001
Atopic dermatitis -1.300 0.001
adrenocortical carcinoma -1.246 0.000
non-small cell lung cancer -1.259 0.000
colon cancer -1.600 0.039
lung cancer -1.500 0.017
active Crohn's disease -1.164 0.046
pilocytic astrocytoma -2.000 0.000
invasive ductal carcinoma -2.800 0.000
Pick disease -1.200 0.002
ductal carcinoma in situ -1.800 0.006
ovarian cancer -1.700 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPL      1 - 70
EQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRV     71 - 140
GLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPR    141 - 210
SGRVLQEANCKNHRVNRVVFLGNMKRLLTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDA    211 - 280
DTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLI    281 - 350
EPISMIVPRRSDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVV    351 - 420
VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC              421 - 480
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
More...