Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.94
PubTator Score 15.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 0.000
osteosarcoma 1.717 0.017
glioblastoma -1.500 0.025
group 3 medulloblastoma 1.900 0.001
atypical teratoid / rhabdoid tumor -2.700 0.003
adrenocortical carcinoma 1.168 0.044
non-small cell lung cancer -1.173 0.000
intraductal papillary-mucinous neoplasm ... -1.200 0.038
colon cancer -1.300 0.046
lung cancer -2.400 0.001
interstitial cystitis 1.100 0.000
Pick disease 1.100 0.005
ductal carcinoma in situ -1.300 0.006
invasive ductal carcinoma -1.600 0.016
ovarian cancer -1.700 0.002
pituitary cancer -1.200 0.005

Synonym

Accession Q9UPZ6
Symbols

Gene

Gene RIF (11)

PMID Text
26393352 Data indicate that enhanced granular expression of phospholipase A2 receptor (PLA2R) and thrombospondin type-1 domain-containing 7A (THSD7A) was detected in 9.1% and 52.7%, respectively, of the patients with idiopathic membranous nephropathy (MN).
26238973 THSD7A is neural N-glycoprotein, which promotes angiogenesis and it is well known that angiogenesis modulates obesity, adipose metabolism and insulin sensitivity, hence our result find a correlation.
25394321 15 of 154 patients with idiopathic membranous nephropathy had circulating autoantibodies to THSD7A but not to PLA2R1, a finding that suggests a distinct subgroup of patients with this condition.
23303384 results suggest that Japanese subjects homozygous for the risk alleles of rs7605378 in FONG and rs12673629 in THSD7A have a significantly higher risk of vertebral fracture
22194972 THSD7A is a membrane-associated N-glycoprotein with a soluble form.
20808825 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20414141 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20020485 Thrombospondin type I domain containing 7A (THSD7A) mediates endothelial cell migration and tube formation.
18488137 Variations may be important determinants of osteoporosis in Japanese women.
More...

AA Sequence

MGLQARRWASGSRGAAGPRRGVLQLLPLPLPLPLLLLLLLRPGAGRAAAQGEAEAPTLYLWKTGPWGRCM      1 - 70
GDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELYDWRLGPWNQCQPVISKSL     71 - 140
EKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPLLEQACLIPCQQDCIVSEFSAWSECSKTC    141 - 210
GSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKN    211 - 280
KEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPM    281 - 350
TFQSCVITKECQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVV    351 - 420
PCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTHKNKEASKPMD    421 - 490
LKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKLRKRRITNEPTGGSGVTGNCP    491 - 560
HLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQEVVCINSDGEEVDRQLCRDAIFPIPVACDAP    561 - 630
CPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQ    631 - 700
TGPWGQCIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKK    701 - 770
DCIVTPYSDWTSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKW    771 - 840
RRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQIPCQDDCQLT    841 - 910
SWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGKVE    911 - 980
VLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKS    981 - 1050
CGSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGE   1051 - 1120
GVQTRKVRCMQNTADGPSEHVEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTQCVLPCNQSSFRQRS   1121 - 1190
ADPIRQPADEGRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVD   1191 - 1260
LKYCEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRPCPSLMD   1261 - 1330
QSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFSKVVDEEFCADIELIIDGNKN   1331 - 1400
MVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQVRSRPVIIQELENQHLCPEQMLETKSCY   1401 - 1470
DGQCYEYKWMASAWKGSSRTVWCQRSDGINVTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGY   1471 - 1540
TEVMSSNSTLEQCTLIPVVVLPTMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYG   1541 - 1610
VAAGAFVLLIFIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM                          1611 - 1657
//

Text Mined References (18)

PMID Year Title
26393352 2015 Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy.
26238973 2015 A novel gene THSD7A is associated with obesity.
25394321 2014 Thrombospondin type-1 domain-containing 7A in idiopathic membranous nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23303384 2013 Association of the formiminotransferase N-terminal sub-domain containing gene and thrombospondin, type 1, domain-containing 7A gene with the prevalence of vertebral fracture in 2427 consecutive autopsy cases.
22889924 2013 Genome-wide association study of Tourette's syndrome.
22194972 2011 Soluble THSD7A is an N-glycoprotein that promotes endothelial cell migration and tube formation in angiogenesis.
20808825 2010 Novel association strategy with copy number variation for identifying new risk Loci of human diseases.
20414141 2010 Family-based association study for bipolar affective disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...