Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.84
PubTator Score 15.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.168 4.4e-02
atypical teratoid / rhabdoid tumor -2.500 3.7e-04
colon cancer -1.300 4.6e-02
ductal carcinoma in situ -1.200 7.1e-03
ependymoma -1.600 3.2e-02
glioblastoma -1.100 2.1e-03
group 3 medulloblastoma 1.900 1.2e-03
interstitial cystitis 1.100 6.2e-05
intraductal papillary-mucinous neoplasm ... -1.200 3.8e-02
invasive ductal carcinoma -1.600 1.6e-02
lung cancer -2.400 7.5e-04
non-small cell lung cancer -1.034 2.4e-09
osteosarcoma 1.717 1.7e-02
ovarian cancer -1.700 2.3e-03
Pick disease 1.100 4.5e-03
pituitary cancer -1.200 5.5e-03

 CSPA Cell Line (1)

Gene RIF (13)

AA Sequence

MGLQARRWASGSRGAAGPRRGVLQLLPLPLPLPLLLLLLLRPGAGRAAAQGEAEAPTLYLWKTGPWGRCM      1 - 70
GDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELYDWRLGPWNQCQPVISKSL     71 - 140
EKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPLLEQACLIPCQQDCIVSEFSAWSECSKTC    141 - 210
GSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKN    211 - 280
KEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPM    281 - 350
TFQSCVITKECQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVV    351 - 420
PCATYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTHKNKEASKPMD    421 - 490
LKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKLRKRRITNEPTGGSGVTGNCP    491 - 560
HLLEAIPCEEPACYDWKAVRLGNCEPDNGKECGPGTQVQEVVCINSDGEEVDRQLCRDAIFPIPVACDAP    561 - 630
CPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQ    631 - 700
TGPWGQCIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKK    701 - 770
DCIVTPYSDWTSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDPLYEEKACEAPQACQSYRWKTHKW    771 - 840
RRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQIPCQDDCQLT    841 - 910
SWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGKVE    911 - 980
VLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKS    981 - 1050
CGSGVKVRSKWLREKPYNGGRPCPKLDHVNQAQVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGE   1051 - 1120
GVQTRKVRCMQNTADGPSEHVEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTQCVLPCNQSSFRQRS   1121 - 1190
ADPIRQPADEGRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVD   1191 - 1260
LKYCEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGRPCPSLMD   1261 - 1330
QSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFSKVVDEEFCADIELIIDGNKN   1331 - 1400
MVLEESCSQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQVRSRPVIIQELENQHLCPEQMLETKSCY   1401 - 1470
DGQCYEYKWMASAWKGSSRTVWCQRSDGINVTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGY   1471 - 1540
TEVMSSNSTLEQCTLIPVVVLPTMEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYG   1541 - 1610
VAAGAFVLLIFIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM                          1611 - 1657
//

Text Mined References (20)

PMID Year Title