| Tbio | Microtubule-associated protein RP/EB family member 3 |
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement (PubMed:28814570). Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules (PubMed:28814570). May play a role in cell migration (By similarity).
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Abortion, Spontaneous | 109 | 0.0 | 0.0 |
| Polycystic ovary syndrome | 360 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| Spontaneous abortion | 113 |
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2843 | 1.5e-24 |
| astrocytoma | 1146 | 6.6e-19 |
| oligodendroglioma | 2850 | 4.0e-18 |
| glioblastoma | 5792 | 2.1e-05 |
| atypical teratoid / rhabdoid tumor | 5112 | 2.1e-05 |
| ovarian cancer | 8520 | 2.8e-05 |
| medulloblastoma, large-cell | 6241 | 2.6e-04 |
| psoriasis | 6694 | 3.0e-04 |
| Pick disease | 1894 | 4.7e-04 |
| dermatomyositis | 966 | 2.1e-03 |
| adult high grade glioma | 3801 | 2.4e-03 |
| Astrocytoma, Pilocytic | 3081 | 7.3e-03 |
| medulloblastoma | 720 | 2.3e-02 |
| subependymal giant cell astrocytoma | 2287 | 2.8e-02 |
| active Crohn's disease | 922 | 3.0e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Burkitt Lymphoma | 20 | 4.203 | 2.1 |
| Infectious mononucleosis | 14 | 3.702 | 1.9 |
| Disease | log2 FC | p |
|---|---|---|
| active Crohn's disease | -1.075 | 3.0e-02 |
| adult high grade glioma | -1.900 | 2.4e-03 |
| astrocytoma | -1.400 | 6.6e-19 |
| Astrocytoma, Pilocytic | -1.100 | 7.3e-03 |
| atypical teratoid / rhabdoid tumor | -1.600 | 2.1e-05 |
| dermatomyositis | -1.400 | 2.1e-03 |
| glioblastoma | -1.500 | 2.1e-05 |
| lung carcinoma | 2.200 | 1.5e-24 |
| medulloblastoma | -1.200 | 2.3e-02 |
| medulloblastoma, large-cell | -1.700 | 2.6e-04 |
| oligodendroglioma | -1.400 | 4.0e-18 |
| ovarian cancer | -1.400 | 2.8e-05 |
| Pick disease | -1.700 | 4.7e-04 |
| psoriasis | -1.200 | 3.0e-04 |
| subependymal giant cell astrocytoma | -1.863 | 2.8e-02 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG |
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE 1 - 70 YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN 71 - 140 PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV 141 - 210 DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE 211 - 280 Y//
