Tbio | Microtubule-associated protein RP/EB family member 3 |
Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Polycystic Ovary Syndrome | 335 |
Spontaneous abortion | 108 |
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2844 | 1.54252988446336E-24 |
astrocytoma | 1493 | 6.57457891073238E-19 |
oligodendroglioma | 2849 | 4.02656921302266E-18 |
psoriasis | 6685 | 6.42140193405154E-6 |
glioblastoma | 5572 | 2.08555719373536E-5 |
atypical teratoid / rhabdoid tumor | 4369 | 2.12220289896025E-5 |
ovarian cancer | 8492 | 2.81276757793342E-5 |
medulloblastoma, large-cell | 6234 | 2.58093510992226E-4 |
Pick disease | 1893 | 4.66312424214044E-4 |
dermatomyositis | 967 | 0.00208025686446524 |
adult high grade glioma | 2148 | 0.00238393895826192 |
sonic hedgehog group medulloblastoma | 1482 | 0.00453677727097424 |
pilocytic astrocytoma | 3086 | 0.00714991537849723 |
subependymal giant cell astrocytoma | 2287 | 0.0281807532356753 |
active Crohn's disease | 918 | 0.0301676720299934 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Burkitt Lymphoma | 19 | 4.238 | 2.1 |
Infectious mononucleosis | 15 | 3.723 | 1.9 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -3.700 | 0.000 |
astrocytoma | -1.400 | 0.000 |
glioblastoma | -1.500 | 0.000 |
oligodendroglioma | -1.400 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.600 | 0.000 |
sonic hedgehog group medulloblastoma | -1.700 | 0.005 |
medulloblastoma, large-cell | -1.700 | 0.000 |
active Crohn's disease | -1.075 | 0.030 |
adult high grade glioma | -1.900 | 0.002 |
pilocytic astrocytoma | -1.100 | 0.007 |
subependymal giant cell astrocytoma | -1.863 | 0.028 |
lung carcinoma | 2.200 | 0.000 |
Pick disease | -1.700 | 0.000 |
ovarian cancer | -1.400 | 0.000 |
dermatomyositis | -1.400 | 0.002 |
Species | Source |
---|---|
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG |
Horse | OMA Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
24478452 | Aptamers binding to human EB1 and EB3, which have sequence requirements similar to but distinct from each other and from Drosophila EB1, were identified. |
24040250 | EB1 and EB3 proteins are obligatory dimers. |
23712260 | Daughter cell adhesion and cytokinesis completion are spatially regulated by distinct states of EB3 phosphorylation on serine 176 by Aurora B. |
23456299 | Findings suggest that methylation-associated down-regulation of EBF3 and IRX1 genes may play an important role in a pathogenic effect of TGF-beta on RASFs. |
23159740 | VE-cadherin outside-in signaling regulates cytosolic calcium homeostasis and EB3 phosphorylation. |
22275434 | decreasing the drebrin E levels disrupted the normal subapical F-actin-myosin-IIB-betaII-spectrin network and the apical accumulation of EB3, a microtubule-plus-end-binding protein |
21768326 | Data indicated that EB1 and EB3 interact with proteins implicated in MT minus-end anchoring or vesicular trafficking to the cilia base, suggesting that EB1 and EB3 promote ciliogenesis by facilitating such trafficking. |
20632835 | study found a polycytosine repeat (C8) in exon 5 of MAPRE3 that could be a potential mutation target in cancers with microsatellite instability (MSI); found that the C8 is frequently mutated in gastric and colorectal carcinomas with MSI |
20008324 | heterodimer formation between EB1 and EB3, but not between EB2 and the other two EBs, occurs both in vitro and in cells as revealed by live cell imaging |
19696028 | Data show that two mitotic kinases, Aurora-A and Aurora-B, phosphorylate endogenous EB3 at Ser-176, and the phosphorylation triggers disruption of the EB3-SIAH-1 complex, resulting in EB3 stabilization during mitosis. |
More... |
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE 1 - 70 YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN 71 - 140 PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV 141 - 210 DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE 211 - 280 Y//
PMID | Year | Title |
---|---|---|
27173435 | 2016 | An organelle-specific protein landscape identifies novel diseases and molecular mechanisms. |
27107012 | 2016 | Pooled-matrix protein interaction screens using Barcode Fusion Genetics. |
25814554 | 2015 | Phospho-tyrosine dependent protein-protein interaction network. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24478452 | 2014 | Peptide aptamers define distinct EB1- and EB3-binding motifs and interfere with microtubule dynamics. |
24040250 | 2013 | End binding proteins are obligatory dimers. |
23712260 | 2013 | Aurora B spatially regulates EB3 phosphorylation to coordinate daughter cell adhesion with cytokinesis. |
23456299 | 2013 | Hypermethylation of EBF3 and IRX1 genes in synovial fibroblasts of patients with rheumatoid arthritis. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
23159740 | 2012 | VE-cadherin signaling induces EB3 phosphorylation to suppress microtubule growth and assemble adherens junctions. |
More... |