Property Summary

NCBI Gene PubMed Count 35
PubMed Score 137.08
PubTator Score 59.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.075 3.0e-02
adult high grade glioma -1.900 2.4e-03
astrocytoma -1.400 6.6e-19
Astrocytoma, Pilocytic -1.100 7.3e-03
atypical teratoid / rhabdoid tumor -1.600 2.1e-05
dermatomyositis -1.400 2.1e-03
glioblastoma -1.500 2.1e-05
lung carcinoma 2.200 1.5e-24
medulloblastoma -1.200 2.3e-02
medulloblastoma, large-cell -1.700 2.6e-04
oligodendroglioma -1.400 4.0e-18
ovarian cancer -1.400 2.8e-05
Pick disease -1.700 4.7e-04
psoriasis -1.200 3.0e-04
subependymal giant cell astrocytoma -1.863 2.8e-02

Gene RIF (16)

AA Sequence

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHE      1 - 70
YIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPN     71 - 140
PGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLV    141 - 210
DLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDE    211 - 280
Y//

Text Mined References (41)

PMID Year Title