Property Summary

NCBI Gene PubMed Count 39
Grant Count 138
R01 Count 91
Funding $67,086,014.69
PubMed Score 280.15
PubTator Score 146.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UPY6 O94974 Q86VQ2 WASP family protein member 3
Symbols SCAR3
WAVE3
Brush-1

Gene

Gene RIF (27)

PMID Text
26977009 Results implicate a contributory role of WAVE1 and -3 to the metastatic phenotype of PC-3 cells through their interaction with the ARP2/3 complex.
25823022 stabilization of WASF3 function occurs through its interaction with ATAD3A and GRP78, which may provide a bridge between the ER and mitochondria, allowing communication between the two organelles
25745180 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25661390 WAVE3 is pivotal in controlling oncogenic phenotypes of human hepatocellular carcinoma cells.
25527710 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25378074 WAVE3 promotes epithelial-mesenchymal transition of gastric cancer through upregulation of Snail.
25329315 We show that WAVE3-mediated modulation of NFkappaB is required for invadopodia formation as well as MMP9 expression and activity that are needed for cancer cells to degrade the ECM
25289936 miR-217 functions as a tumor-suppressive miRNA and inhibits the osteosarcoma tumorigenesis through targeting WASF3.
24197660 Upregulated WAVE3 expression is essential for TGF-beta-mediated EMT and metastasis of triple-negative breast cancer cells.
23677069 these results define a novel signaling network whereby JAK2/STAT3 signaling creates a feed-forward loop to raise activated WASF3 levels that promote cancer cell motility.
More...

AA Sequence

MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQ      1 - 70
DRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPY     71 - 140
RDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQKEQKRIDGTTREVKKVRKARNRRQEWNMMAY    141 - 210
DKELRPDNRLSQSVYHGASSEGSLSPDTRSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQ    211 - 280
AAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPP    281 - 350
VIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH    351 - 420
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSD    421 - 490
DDSEFDENDWSD                                                              491 - 502
//

Text Mined References (40)

PMID Year Title
26977009 2016 The Association Between WAVE1 and -3 and the ARP2/3 Complex in PC 3 Cells.
25823022 2016 Mitochondrial ATAD3A combines with GRP78 to regulate the WASF3 metastasis-promoting protein.
25661390 2015 Overexpression of WAVE3 promotes tumor invasiveness and confers an unfavorable prognosis in human hepatocellular carcinoma.
25378074 2014 WAVE3 promotes epithelial-mesenchymal transition of gastric cancer through upregulation of Snail.
25329315 2014 WAVE3-NF?B interplay is essential for the survival and invasion of cancer cells.
25289936 2014 MicroRNA-217 regulates WASF3 expression and suppresses tumor growth and metastasis in osteosarcoma.
24197660 2013 Upregulated WAVE3 expression is essential for TGF-?-mediated EMT and metastasis of triple-negative breast cancer cells.
23677069 2013 Critical role of the WASF3 gene in JAK2/STAT3 regulation of cancer cell motility.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23318438 2014 WASF3 regulates miR-200 inactivation by ZEB1 through suppression of KISS1 leading to increased invasiveness in breast cancer cells.
More...