Property Summary

NCBI Gene PubMed Count 39
PubMed Score 280.15
PubTator Score 146.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer 1.100 4.0e-03
pancreatic cancer 2.100 2.2e-04
posterior fossa group A ependymoma -1.300 6.6e-08
glioblastoma -2.500 4.8e-03
cystic fibrosis 1.257 4.0e-05
atypical teratoid / rhabdoid tumor -2.700 1.8e-05
primitive neuroectodermal tumor -1.400 2.9e-05
Atopic dermatitis -1.100 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.177 1.5e-03
non-small cell lung cancer -1.584 2.3e-13
intraductal papillary-mucinous adenoma (... -1.400 1.9e-02
intraductal papillary-mucinous carcinoma... -1.800 4.0e-03
interstitial cystitis -1.100 1.1e-02
lung adenocarcinoma -1.500 1.3e-08
pediatric high grade glioma -2.200 4.4e-06
pilocytic astrocytoma -1.300 3.6e-06
pancreatic carcinoma 2.100 2.2e-04
subependymal giant cell astrocytoma -1.976 1.2e-03
breast carcinoma -1.400 5.3e-28
Breast cancer -2.200 5.8e-07
ductal carcinoma in situ -1.600 8.0e-03
invasive ductal carcinoma -2.500 2.6e-04
ovarian cancer -3.200 4.6e-12
pituitary cancer 1.100 1.9e-04

Gene RIF (27)

PMID Text
26977009 Results implicate a contributory role of WAVE1 and -3 to the metastatic phenotype of PC-3 cells through their interaction with the ARP2/3 complex.
25823022 stabilization of WASF3 function occurs through its interaction with ATAD3A and GRP78, which may provide a bridge between the ER and mitochondria, allowing communication between the two organelles
25745180 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25661390 WAVE3 is pivotal in controlling oncogenic phenotypes of human hepatocellular carcinoma cells.
25527710 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25378074 WAVE3 promotes epithelial-mesenchymal transition of gastric cancer through upregulation of Snail.
25329315 We show that WAVE3-mediated modulation of NFkappaB is required for invadopodia formation as well as MMP9 expression and activity that are needed for cancer cells to degrade the ECM
25289936 miR-217 functions as a tumor-suppressive miRNA and inhibits the osteosarcoma tumorigenesis through targeting WASF3.
24197660 Upregulated WAVE3 expression is essential for TGF-beta-mediated EMT and metastasis of triple-negative breast cancer cells.
23677069 these results define a novel signaling network whereby JAK2/STAT3 signaling creates a feed-forward loop to raise activated WASF3 levels that promote cancer cell motility.
23318438 ZEB1/2 upregulation by WASF3 results from downregulation of KISS1, leading to the release of inhibition of nuclear factor (NF)kappaB by IkappaBalpha
22952619 increased expression levels of WAVE3 are associated with the progression and metastasis of triple negative breast cancer
22909346 WAVE3-depleted breast cancer cells move more slowly but more persistently on a 2-dimensional matrix. They typically only show one lamellipod. WAVE3 appears to have no role in driving invasiveness. Lamellipodial persistence is not crucial in 3-dimensions.
22806308 MMP-9 and WAVE3 were over-expressed in colorectal cancer tissues compared with normal mucosa.
22581642 demonstrate WASF3 is a HIF1A-regulated gene and suggests a mechanism to explain the observation of elevated expression of WASF3 in advanced stage tumors
22315230 HSP90 and HSP70 proteins are essential for stabilization and activation of WASF3 metastasis-promoting protein.
21544801 coordinated expression patterns of the WASF3 metastasis promoter gene and the KISS1 metastasis suppressor gene appear to exert their influence through inhibition of NF-kappaB signaling, which in turn regulates MMP-9 production facilitating invasion.
21105030 The study also identifies a critical role for WAVE3, downstream of miR-31, in the invasion-metastasis cascade.
19801681 Studies identified a novel mechanism for the regulation of WAVE3 expression in cancer cells, which controls the invasive properties and morphology of cancer cells associated with their metastatic potential.
19395286 WAVE3 is pivotal in controlling the invasiveness of prostate cancer cells.
17623672 the activation of WAVE3 to promote actin remodeling is enhanced by the c-Abl-mediated tyrosine phosphorylation of WAVE3.
15907837 The WAVE3 is a member of the WASP/WAVE family of proteins, which play a critical role in the regulation of actin polymerization, cytoskeleton organization, and cell motility.
15826941 WAVE3-mediated migration in MDA-MB-231 cells via lamellipodia formation is activated downstream of PI3K and induced by PDGF
15752430 all three Scar/WAVE isoforms behave similarly and are likely to participate in the same kinds of protein complexes that regulate actin assembly
15670045 during megakaryocytic differentiation, platelets expressed WAVE-1 and WAVE-2, whereas WAVE-3 expression was hardly to be detected. WAVE-3 expression was not changed by the differentiation
15280206 the 3 WAVE isoforms exhibit common and distinct features and may potentially be involved in the regulation of actin cytoskeleton in platelets
12185600 patient with ganglioneuroblastoma carries an apparently balanced t(1:13)(q21:q12) reciprocal translocation. Positional cloning of the translocation breakpoint on chromosome 13 resulted in the mapping of the breakpoint between coding exon 2 and 3 of WAVE3

AA Sequence

MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEANNFYIRANSLQ      1 - 70
DRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPY     71 - 140
RDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQKEQKRIDGTTREVKKVRKARNRRQEWNMMAY    141 - 210
DKELRPDNRLSQSVYHGASSEGSLSPDTRSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQ    211 - 280
AAEHEYRPPSASARHMALNRPQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPP    281 - 350
VIPSAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH    351 - 420
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSD    421 - 490
DDSEFDENDWSD                                                              491 - 502
//

Text Mined References (40)

PMID Year Title
26977009 2016 The Association Between WAVE1 and -3 and the ARP2/3 Complex in PC 3 Cells.
25823022 2016 Mitochondrial ATAD3A combines with GRP78 to regulate the WASF3 metastasis-promoting protein.
25661390 2015 Overexpression of WAVE3 promotes tumor invasiveness and confers an unfavorable prognosis in human hepatocellular carcinoma.
25378074 2014 WAVE3 promotes epithelial-mesenchymal transition of gastric cancer through upregulation of Snail.
25329315 2014 WAVE3-NF?B interplay is essential for the survival and invasion of cancer cells.
25289936 2014 MicroRNA-217 regulates WASF3 expression and suppresses tumor growth and metastasis in osteosarcoma.
24197660 2013 Upregulated WAVE3 expression is essential for TGF-?-mediated EMT and metastasis of triple-negative breast cancer cells.
23677069 2013 Critical role of the WASF3 gene in JAK2/STAT3 regulation of cancer cell motility.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23318438 2014 WASF3 regulates miR-200 inactivation by ZEB1 through suppression of KISS1 leading to increased invasiveness in breast cancer cells.
22952619 2012 Increased expression levels of WAVE3 are associated with the progression and metastasis of triple negative breast cancer.
22909346 2012 Scar/WAVE3 contributes to motility and plasticity of lamellipodial dynamics but not invasion in three dimensions.
22806308 2012 Expression of MMP-9 and WAVE3 in colorectal cancer and its relationship to clinicopathological features.
22581642 2012 HIF1A induces expression of the WASF3 metastasis-associated gene under hypoxic conditions.
22315230 2012 HSP90 and HSP70 proteins are essential for stabilization and activation of WASF3 metastasis-promoting protein.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21544801 2011 Functional interrelationship between the WASF3 and KISS1 metastasis-associated genes in breast cancer cells.
21105030 2011 WAVE3, an actin remodeling protein, is regulated by the metastasis suppressor microRNA, miR-31, during the invasion-metastasis cascade.
19801681 2009 The miR200 family of microRNAs regulates WAVE3-dependent cancer cell invasion.
19395286 WAVE3 is associated with invasiveness in prostate cancer cells.
17623672 2007 c-Abl-mediated phosphorylation of WAVE3 is required for lamellipodia formation and cell migration.
15907837 2005 WAVE3 promotes cell motility and invasion through the regulation of MMP-1, MMP-3, and MMP-9 expression.
15826941 2005 WAVE3-mediated cell migration and lamellipodia formation are regulated downstream of phosphatidylinositol 3-kinase.
15752430 2005 Inclusion of Scar/WAVE3 in a similar complex to Scar/WAVE1 and 2.
15670045 2005 Expression and subcellular localization of WAVE isoforms in the megakaryocyte/platelet lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280206 2005 WAVE/Scars in platelets.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12856283 2003 Genomic organization and expression profile of the human and mouse WAVE gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185600 2002 WAVE3, an actin-polymerization gene, is truncated and inactivated as a result of a constitutional t(1;13)(q21;q12) chromosome translocation in a patient with ganglioneuroblastoma.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11246027 2001 The Wiskott-Aldrich syndrome protein (WASP) family.
11146629 2001 Interaction of WASP/Scar proteins with actin and vertebrate Arp2/3 complex.
11073096 2000 Cellular signaling in macrophage migration and chemotaxis.
10381382 1999 Identification of two human WAVE/SCAR homologues as general actin regulatory molecules which associate with the Arp2/3 complex.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9732292 1998 SCAR, a WASP-related protein, isolated as a suppressor of receptor defects in late Dictyostelium development.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8137235 1994 A candidate tumor suppressor gene in human breast cancers.