Property Summary

NCBI Gene PubMed Count 49
PubMed Score 384.98
PubTator Score 185.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.17282518573182E-181
non-small cell lung cancer 2798 3.6536551670999E-11
tuberculosis 1563 3.75169727472503E-9
ulcerative colitis 2087 9.57307359832247E-9
group 4 medulloblastoma 1875 2.03134239472487E-7
lung cancer 4473 9.67819650498815E-7
posterior fossa group B ependymoma 1530 2.67021992839795E-6
lung adenocarcinoma 2714 8.88970178330779E-6
permanent atrial fibrillation 44 7.82532570460189E-5
cystic fibrosis 1670 5.46194214489962E-4
pancreatic cancer 2300 5.8436638412616E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00361851606973487
colon cancer 1475 0.00386725544586832
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0040023746243875
medulloblastoma, large-cell 6234 0.00438415945530363
atypical teratoid / rhabdoid tumor 4369 0.00444269111845218
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0064376003453004
invasive ductal carcinoma 2950 0.0120302976633112
interstitial cystitis 2299 0.019264195971809
osteosarcoma 7933 0.0207289033156355
non primary Sjogren syndrome sicca 840 0.0251977678366507
Breast cancer 3099 0.0259889637897627
glioblastoma 5572 0.026111815804123
active Crohn's disease 918 0.0280735334362029
Barrett's esophagus 185 0.032857846643712
ductal carcinoma in situ 1745 0.0346018915526596
pituitary cancer 1972 0.0386011265895508
progressive supranuclear palsy 674 0.041299360427838
head and neck cancer and chronic obstructive pulmonary disease 237 0.0497469769304194
Disease Target Count Z-score Confidence
Cancer 2346 3.758 1.9
Dyscalculia 6 3.679 1.8
Spondylolysis 9 3.235 1.6
Cystinuria 18 3.085 1.5

Expression

Synonym

Accession Q9UPY5 A8K2U4
Symbols xCT
CCBR1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (35)

PMID Text
26540405 Study demonstrated that the mRNA expression levels of the two system xc- subunits, SLC7A11 and SLC3A2, in peripheral white blood cells are lowered in patients with schizophrenia than healthy individuals
26254540 Sulfasalazine, a relatively non-toxic drug that targets cystine transporter, may, in combination with CDDP, be an effective therapy for colorectal cancer.
26252954 the rate of cystine uptake was significantly faster than the rate of glutamate release in human glioma cells.
26019222 increased SLC7A11 expression predicted shorter malignant glioma patient survival.
25860939 We discovered that many genes involved in oxidative stress/antioxidant defense system, apoptosis/anti-apoptosis/cell death, and cellular response to unfolded proteins/topologically incorrect proteins are potentially regulated by xCT.
25399695 Data indicate that cystine-glutamate exchange transporter protein SLC7A11 mRNA is regulated by cellular stress and nonsense-mediated RNA decay (NMD).
25002527 Results show that Nrf2 and ATF4 were upregulated by proteasome inhibition and cooperatively enhance human xCT gene expression upon proteasome inhibition.
24686172 IGF-I regulates cystine uptake and cellular redox status by activating the expression and function of xCT in estrogen receptor-positive (ER(+)) breast cancer cells by a mechanism that relies on the IGF receptor substrate-1 (IRS-1).
24516043 Our findings indicate that miRNA-27a negatively regulates SLC7A11 in cisplatin-resistant bladder cancer, and shows promise as a marker for patients likely to benefit from cisplatin-based chemotherapy
24094812 the xCT antiporter, which is expressed on one-third of triple-negative breast tumors in this study, may have a role in glutamine updake and dependence
More...

AA Sequence

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVL      1 - 70
QNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATA     71 - 140
VISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGV    141 - 210
MQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIG    211 - 280
YVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGH    281 - 350
LPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP    351 - 420
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQI    421 - 490
ILEVVPEEDKL                                                               491 - 501
//

Text Mined References (53)

PMID Year Title
26540405 2016 Decreased mRNA expression for the two subunits of system xc(-), SLC3A2 and SLC7A11, in WBC in patients with schizophrenia: Evidence in support of the hypo-glutamatergic hypothesis of schizophrenia.
26254540 2015 Xc- inhibitor sulfasalazine sensitizes colorectal cancer to cisplatin by a GSH-dependent mechanism.
26252954 2015 High-Throughput Assay Development for Cystine-Glutamate Antiporter (xc-) Highlights Faster Cystine Uptake than Glutamate Release in Glioma Cells.
26019222 2015 SLC7A11 expression is associated with seizures and predicts poor survival in patients with malignant glioma.
25860939 2015 Genomic analysis of xCT-mediated regulatory network: Identification of novel targets against AIDS-associated lymphoma.
25399695 2015 Stress-induced inhibition of nonsense-mediated RNA decay regulates intracellular cystine transport and intracellular glutathione through regulation of the cystine/glutamate exchanger SLC7A11.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
25002527 2014 Nrf2- and ATF4-dependent upregulation of xCT modulates the sensitivity of T24 bladder carcinoma cells to proteasome inhibition.
24686172 2014 IGF-I regulates redox status in breast cancer cells by activating the amino acid transport molecule xC-.
24516043 2014 Reduced expression of miRNA-27a modulates cisplatin resistance in bladder cancer by targeting the cystine/glutamate exchanger SLC7A11.
More...