Property Summary

NCBI Gene PubMed Count 39
PubMed Score 71.41
PubTator Score 655.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -2.900 2.9e-06
astrocytic glioma -1.700 8.7e-03
Astrocytoma, Pilocytic -4.400 2.1e-11
atypical teratoid / rhabdoid tumor -3.900 2.4e-10
Breast cancer -1.500 1.4e-07
chronic rhinosinusitis -1.198 3.5e-02
cystic fibrosis and chronic rhinosinusit... -1.123 4.7e-02
ependymoma -2.800 8.1e-10
glioblastoma -3.300 6.8e-10
group 3 medulloblastoma -2.500 1.0e-03
interstitial cystitis -1.600 1.6e-03
intraductal papillary-mucinous adenoma (... 1.100 9.8e-03
lung cancer -2.100 1.0e-04
lung carcinoma -1.700 2.6e-22
malignant mesothelioma -1.800 5.9e-07
medulloblastoma, large-cell -3.500 3.0e-06
non-small cell lung cancer -1.382 2.5e-17
oligodendroglioma -1.500 1.1e-02
ovarian cancer -2.900 1.3e-06
Pick disease -1.200 3.1e-02
pituitary cancer -1.300 2.3e-03
primitive neuroectodermal tumor -1.800 5.4e-03
severe Alzheimer's disease -1.036 2.7e-02

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MKSLLNAFTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNASAPDWAVCSTATSHRSLSPQL      1 - 70
LQQMPSKPEGAAKTIGSYVPGPRSRSPSLNRLGGAGEDGKRPQPLWHVGSPFALGANKDSLSAFEYPGPK     71 - 140
RKLYSAVPGRLFVAVKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRD    141 - 210
SQAETRADRSKKLFRHYTVGSYDSFDTSSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAF    211 - 280
PALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDPDDTA    281 - 350
RKKAPPPPKRAPTTALTLRSKSMTSELEELVDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQ    351 - 420
RPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP    421 - 490
PMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPKSPTPRVYGTIKPAFNQNSAAKVSPATRSD    491 - 560
TVATMMREKGMYFRRELDRYSLDSEDLYSRNAGPQANFRNKRGQMPENPYSEVGKIASKAVYVPAKPARR    561 - 630
KGMLVKQSNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQAPEPPSQLRPDESLTVSSPFA    631 - 700
AAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRTRPSMFPEEGDFADEDSAEQLSSPMPSAT    701 - 770
PREPENHFVGGAEASAPGEAGRPLNSTSKAQGPESSPAVPSASSGTAGPGNYVHPLTGRLLDPSSPLALA    771 - 840
LSARDRAMKESQQGPKGEAPKADLNKPLYIDTKMRPSLDAGFPTVTRQNTRGPLRRQETENKYETDLGRD    841 - 910
RKGDDKKNMLIDIMDTSQQKSAGLLMVHTVDATKLDNALQEEDEKAEVEMKPDSSPSEVPEGVSETEGAL    911 - 980
QISAAPEPTTVPGRTIVAVGSMEEAVILPFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRAA    981 - 1050
SVPALSDLVKQKKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDAVADSGIEEVDSRSS   1051 - 1120
SDHHLETTSTISTVSSISTLSSEGGENVDTCTVYADGQAFMVDKPPVPPKPKMKPIIHKSNALYQDALVE   1121 - 1190
EDVDSFVIPPPAPPPPPGSAQPGMAKVLQPRTSKLWGDVTEIKSPILSGPKANVISELNSILQQMNREKL   1191 - 1260
AKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGTRRAPS   1261 - 1330
PVVSPTEMNKETLPAPLSAATASPSPALSDVFSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNKPFT   1331 - 1400
TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR   1401 - 1470
//

Text Mined References (41)

PMID Year Title