Property Summary

NCBI Gene PubMed Count 36
PubMed Score 63.68
PubTator Score 655.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 2.55645932692365E-22
non-small cell lung cancer 2798 2.54478156942024E-17
oligodendroglioma 2849 7.98299503645097E-15
pilocytic astrocytoma 3086 3.94676419078985E-13
posterior fossa group A ependymoma 1511 1.20151192610841E-12
atypical teratoid / rhabdoid tumor 4369 2.22758340321749E-12
Breast cancer 3099 1.44414664943176E-9
pediatric high grade glioma 2712 1.99207636316076E-8
glioblastoma 5572 2.61319896494408E-8
medulloblastoma 1524 5.39737036699402E-7
malignant mesothelioma 3163 5.89125630551789E-7
ovarian cancer 8492 1.25883884246147E-6
interstitial cystitis 2299 7.15911384873757E-6
medulloblastoma, large-cell 6234 7.31858825456298E-6
lung cancer 4473 1.04320427058918E-4
pituitary cancer 1972 0.00189132240232166
primitive neuroectodermal tumor 3031 0.0036504061500582
astrocytoma 1493 0.00494231170696205
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00977797901671335
severe Alzheimer's disease 49 0.0273584739472699
Pick disease 1893 0.0307200260028653
chronic rhinosinusitis 512 0.0346278177461692
cystic fibrosis and chronic rhinosinusitis 213 0.046909314905203
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 2.0
Malignant glioma 23 0.0 2.0
Disease Target Count Z-score Confidence
Secretory diarrhea 6 3.987 2.0
Schizophrenia 503 3.034 1.5
Disease Target Count
Autism 17 1

Expression

  Differential Expression (23)

Synonym

Accession Q9UPX8 C0SPG8 C0SPG9 Q3Y8G9 Q52LK2 Q9UKP1 Shank2
Symbols SHANK
AUTS17
CORTBP1
CTTNBP1
ProSAP1
SPANK-3

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (12)

PMID Text
25560758 variants in the SHANK2 gene in a schizophrenia patient cohort
24811177 Knockdown of endogenous Shank2E or overexpression of a dominant-negative Shank2E mutant inhibited the glucocorticoid-mediated increase in CFTR.
24751538 syndapin I functions reflected direct, SH3 domain-mediated associations and functional interactions with ProSAP1/Shank2.
23468870 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
22699619 deletion of ProSAP1/Shank2 results in an early, brain-region-specific upregulation of ionotropic glutamate receptors at the synapse and increased levels of ProSAP2/Shank3
22346768 we confirmed that de novo SHANK2 deletions are present in patients with ASD and showed that several SHANK2 variants reduce the number of synapses in vitro
21994763 dominant negative effect translates into dose-dependent altered cognitive behavior of SHANK2-R462X-expressing mice, with an impact on the penetrance of ASD
20531469 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20473310 Observational study of gene-disease association. (HuGE Navigator)
20473310 we identified de novo copy number variations in the SHANK2 synaptic scaffolding gene in two unrelated individuals with autism-spectrum disorder (ASD) and mental retardation
More...

AA Sequence

MKSLLNAFTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNASAPDWAVCSTATSHRSLSPQL      1 - 70
LQQMPSKPEGAAKTIGSYVPGPRSRSPSLNRLGGAGEDGKRPQPLWHVGSPFALGANKDSLSAFEYPGPK     71 - 140
RKLYSAVPGRLFVAVKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRD    141 - 210
SQAETRADRSKKLFRHYTVGSYDSFDTSSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAF    211 - 280
PALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTVTRNLDPDDTA    281 - 350
RKKAPPPPKRAPTTALTLRSKSMTSELEELVDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQ    351 - 420
RPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP    421 - 490
PMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPKSPTPRVYGTIKPAFNQNSAAKVSPATRSD    491 - 560
TVATMMREKGMYFRRELDRYSLDSEDLYSRNAGPQANFRNKRGQMPENPYSEVGKIASKAVYVPAKPARR    561 - 630
KGMLVKQSNVEDSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQAPEPPSQLRPDESLTVSSPFA    631 - 700
AAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRTRPSMFPEEGDFADEDSAEQLSSPMPSAT    701 - 770
PREPENHFVGGAEASAPGEAGRPLNSTSKAQGPESSPAVPSASSGTAGPGNYVHPLTGRLLDPSSPLALA    771 - 840
LSARDRAMKESQQGPKGEAPKADLNKPLYIDTKMRPSLDAGFPTVTRQNTRGPLRRQETENKYETDLGRD    841 - 910
RKGDDKKNMLIDIMDTSQQKSAGLLMVHTVDATKLDNALQEEDEKAEVEMKPDSSPSEVPEGVSETEGAL    911 - 980
QISAAPEPTTVPGRTIVAVGSMEEAVILPFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRAA    981 - 1050
SVPALSDLVKQKKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDAVADSGIEEVDSRSS   1051 - 1120
SDHHLETTSTISTVSSISTLSSEGGENVDTCTVYADGQAFMVDKPPVPPKPKMKPIIHKSNALYQDALVE   1121 - 1190
EDVDSFVIPPPAPPPPPGSAQPGMAKVLQPRTSKLWGDVTEIKSPILSGPKANVISELNSILQQMNREKL   1191 - 1260
AKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTVRPGTSQPITLQSRPPDYESRTSGTRRAPS   1261 - 1330
PVVSPTEMNKETLPAPLSAATASPSPALSDVFSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNKPFT   1331 - 1400
TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR   1401 - 1470
//

Text Mined References (38)

PMID Year Title
25560758 2015 Identification and functional characterization of rare SHANK2 variants in schizophrenia.
24811177 2014 Serum- and glucocorticoid-induced protein kinase 1 (SGK1) increases the cystic fibrosis transmembrane conductance regulator (CFTR) in airway epithelial cells by phosphorylating Shank2E protein.
24751538 2014 ProSAP1 and membrane nanodomain-associated syndapin I promote postsynapse formation and function.
24124131 2014 The emerging role of SHANK genes in neuropsychiatric disorders.
23468870 2013 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
23432519 A genome-wide association study of recipient genotype and medium-term kidney allograft function.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22699620 2012 Autistic-like social behaviour in Shank2-mutant mice improved by restoring NMDA receptor function.
22699619 2012 Autistic-like behaviours and hyperactivity in mice lacking ProSAP1/Shank2.
More...