Property Summary

NCBI Gene PubMed Count 12
Grant Count 19
R01 Count 16
Funding $3,008,251
PubMed Score 46.35
PubTator Score 10.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.700 0.007
oligodendroglioma -1.300 0.028
glioblastoma multiforme -1.200 0.000
osteosarcoma -2.128 0.000
ependymoma -1.200 0.000
non-small cell lung cancer -1.297 0.000
lung adenocarcinoma -1.200 0.000
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
25381060 we identified seven new putative CCP1 substrates, all of them harboring acidic amino acids in their gene-encoded C terminus
23242554 Data indicate that a functional nuclear export signals (NESs) in CCP1 that mediates direct binding to the export receptor CRM1.

AA Sequence

MSKLKVIPEKSLTNNSRIVGLLAQLEKINAEPSESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEIL      1 - 70
LSTLENTKDLQTTLNILSILVELVSAGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILA     71 - 140
KIGPKDKKFGVKARINGALNITLNLVKQNLQNHRLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIG    141 - 210
PFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVT    211 - 280
NIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLPVIPVT    281 - 350
GPVAQLYSLPPEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIETDINKLKPQQEPGRTIEDLK    351 - 420
MYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKENISSKGDEGEK    421 - 490
KSTFMDLAKEDIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQNIPSQTAPGFTAEMKKDCSL    491 - 560
PLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY    561 - 630
IEIVKNTKSVPEYSEVAYPDYFGHIPPPFKEPILERPYGVQRTKIAQDIERLIHQSDIIDRVVYDLDNPN    631 - 700
YTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCE    701 - 770
KSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDD    771 - 840
VCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYEHICHFRNR    841 - 910
PYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNR    911 - 980
QWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNDNATSCDVVE    981 - 1050
DTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGT   1051 - 1120
RELEEMGAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAE   1121 - 1190
SNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP                                     1191 - 1226
//

Text Mined References (22)

PMID Year Title
25381060 2015 C-terminomics screen for natural substrates of cytosolic carboxypeptidase 1 reveals processing of acidic protein C termini.
23242554 2013 Identification of CRM1-dependent Nuclear Export Cargos Using Quantitative Mass Spectrometry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085998 2013 Functional segregation and emerging role of cilia-related cytosolic carboxypeptidases (CCPs).
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...