Property Summary

NCBI Gene PubMed Count 12
PubMed Score 47.16
PubTator Score 10.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Nerve Degeneration 121 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 1.6e-21
lung adenocarcinoma 2716 3.6e-15
ependymoma 4679 5.2e-09
osteosarcoma 7950 1.4e-05
ovarian cancer 8520 2.5e-05
glioblastoma 5792 2.5e-03
astrocytic glioma 2597 6.7e-03
oligodendroglioma 2850 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.700 6.7e-03
ependymoma -1.200 5.2e-09
glioblastoma -1.100 2.5e-03
lung adenocarcinoma -1.200 3.6e-15
non-small cell lung cancer -1.297 1.6e-21
oligodendroglioma -1.300 2.8e-02
osteosarcoma -2.128 1.4e-05
ovarian cancer -1.100 2.5e-05

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MSKLKVIPEKSLTNNSRIVGLLAQLEKINAEPSESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEIL      1 - 70
LSTLENTKDLQTTLNILSILVELVSAGGGRRVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILA     71 - 140
KIGPKDKKFGVKARINGALNITLNLVKQNLQNHRLVLPCLQLLRVYSANSVNSVSLGKNGVVELMFKIIG    141 - 210
PFSKKNSSLIKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVT    211 - 280
NIKLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLPVIPVT    281 - 350
GPVAQLYSLPPEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIETDINKLKPQQEPGRTIEDLK    351 - 420
MYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKENISSKGDEGEK    421 - 490
KSTFMDLAKEDIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQNIPSQTAPGFTAEMKKDCSL    491 - 560
PLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETEDDEDTESNSSVEQASVEVPDGPTLHDPDLY    561 - 630
IEIVKNTKSVPEYSEVAYPDYFGHIPPPFKEPILERPYGVQRTKIAQDIERLIHQSDIIDRVVYDLDNPN    631 - 700
YTIPEEGDILKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCE    701 - 770
KSNSQFNYGMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDD    771 - 840
VCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYEHICHFRNR    841 - 910
PYVFLSARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNR    911 - 980
QWQSPSPDLHPTIYHAKGLLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNDNATSCDVVE    981 - 1050
DTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGT   1051 - 1120
RELEEMGAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAE   1121 - 1190
SNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP                                     1191 - 1226
//

Text Mined References (22)

PMID Year Title