Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.57
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.88483712706635E-6
atypical teratoid / rhabdoid tumor 4369 3.48357937074685E-5
lung cancer 4473 4.88962061203153E-5
medulloblastoma, large-cell 6234 9.32509259777333E-5
Multiple myeloma 1328 6.3090056298823E-4
group 4 medulloblastoma 1875 0.00140885195608303
glioblastoma 5572 0.00354139077703959
astrocytic glioma 2241 0.0173959564808979
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 3.424 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.434 0.001
astrocytic glioma 1.200 0.017
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.300 0.004
group 4 medulloblastoma 1.700 0.001
medulloblastoma, large-cell 2.100 0.000
lung cancer 1.600 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9UPW0 A7MBL7 A7MD18 D3DPW2 Q9NSS7
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
26578569 FOXO3-dependent gene regulation is generally mediated not through uniquely bound regions but through regions occupied by both FOXK2 and FOXO3 where both factors play a regulatory role.
24846831 This study demonstrated that miR-517a-3p promoted lung cancer cell proliferation and invasion by targeting of FOXJ3 expression
23933633 FOXJ3 may be associated with the development of rheumatoid arthritis.
22740631 FOXJ3 is identified as a novel cell cycle reguulator that may regulate a network of zinc finger proteins.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGLYGQACPSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEE      1 - 70
VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVP     71 - 140
RSKDDPGKGSYWAIDTNPKEDVLPTRPKKRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNK    141 - 210
VTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQPQYNLPERDK    211 - 280
QLLFSEYNFEDLSASFRSLYKSVFEQSLSQQGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLS    281 - 350
NSHGSGLNTTGSNSVAQVSLSHPQMHTQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHPSP    351 - 420
HQHIQHHPNHQHQTLTHQAPPPPQQVSCNSGVSNDWYATLDMLKESCRIASSVNWSDVDLSQFQGLMESM    421 - 490
RQADLKNWSLDQVQFADLCSSLNQFFTQTGLIHSQSNVQQNVCHGAMHPTKPSQHIGTGNLYIDSRQNLP    491 - 560
PSVMPPPGYPHIPQALSTPGTTMAGHHRAMNQQHMMPSQAFQMRRSLPPDDIQDDFDWDSIV            561 - 622
//

Text Mined References (20)

PMID Year Title
26578569 2016 Genome-wide binding studies reveal DNA binding specificity mechanisms and functional interplay amongst Forkhead transcription factors.
24846831 2014 MiR-517a-3p accelerates lung cancer cell proliferation and invasion through inhibiting FOXJ3 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23933633 2013 Association of forkhead box J3 (FOXJ3) polymorphisms with rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22740631 2012 Live-cell monitoring of periodic gene expression in synchronous human cells identifies Forkhead genes involved in cell cycle control.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...