Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.67
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.200 1.7e-02
atypical teratoid / rhabdoid tumor 1.300 3.5e-05
glioblastoma 1.300 3.5e-03
group 4 medulloblastoma 1.700 1.4e-03
lung cancer 1.100 4.2e-03
medulloblastoma, large-cell 2.100 9.3e-05
Multiple myeloma 1.434 6.3e-04
ovarian cancer -1.500 1.9e-06

Gene RIF (5)

AA Sequence

MGLYGQACPSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEE      1 - 70
VQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVP     71 - 140
RSKDDPGKGSYWAIDTNPKEDVLPTRPKKRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNK    141 - 210
VTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPVTSHPESVSQSLTPQQQPQYNLPERDK    211 - 280
QLLFSEYNFEDLSASFRSLYKSVFEQSLSQQGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLS    281 - 350
NSHGSGLNTTGSNSVAQVSLSHPQMHTQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHPSP    351 - 420
HQHIQHHPNHQHQTLTHQAPPPPQQVSCNSGVSNDWYATLDMLKESCRIASSVNWSDVDLSQFQGLMESM    421 - 490
RQADLKNWSLDQVQFADLCSSLNQFFTQTGLIHSQSNVQQNVCHGAMHPTKPSQHIGTGNLYIDSRQNLP    491 - 560
PSVMPPPGYPHIPQALSTPGTTMAGHHRAMNQQHMMPSQAFQMRRSLPPDDIQDDFDWDSIV            561 - 622
//

Text Mined References (21)

PMID Year Title