Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.40
PubTator Score 18.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute myeloid leukemia -1.300 1.4e-02
acute quadriplegic myopathy -2.066 5.8e-06
Amyotrophic lateral sclerosis -1.168 9.6e-04
Atopic dermatitis -1.500 7.6e-05
atypical teratoid / rhabdoid tumor 1.400 4.4e-04
autosomal dominant Emery-Dreifuss muscul... -1.690 2.3e-03
Breast cancer -1.300 1.5e-06
breast carcinoma -1.200 6.3e-22
colon cancer -2.200 8.2e-05
cutaneous lupus erythematosus 1.100 5.7e-04
Duchenne muscular dystrophy -2.018 4.5e-09
ductal carcinoma in situ -1.600 4.2e-04
group 3 medulloblastoma -3.000 6.2e-07
intraductal papillary-mucinous adenoma (... -1.300 1.9e-02
intraductal papillary-mucinous carcinoma... -1.800 1.2e-02
invasive ductal carcinoma -2.400 3.2e-04
juvenile dermatomyositis -1.234 6.3e-08
limb girdle muscular dystrophy 2A -1.762 8.7e-07
lung adenocarcinoma -1.131 1.4e-06
lung cancer -2.300 6.8e-04
lung carcinoma -1.600 1.2e-16
medulloblastoma, large-cell -3.500 1.0e-05
non-small cell lung cancer -1.434 8.7e-12
osteosarcoma 1.234 3.7e-02
ovarian cancer -2.000 5.0e-09
psoriasis -1.300 2.7e-05
tuberculosis 1.300 2.3e-02

Protein-protein Interaction (11)

Gene RIF (5)

AA Sequence

MMFRDQVGVLAGWFKGWNECEQTVALLSLLKRVSQTQARFLQLCLEHSLADCAELHVLEREANSPGIINQ      1 - 70
WQQESKDKVISLLLTHLPLLKPGNLDAKVEYMKLLPKILAHSIEHNQHIEESRQLLSYALIHPATSLEDR     71 - 140
SALAMWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSRDSGICINASNWQDKSM    141 - 210
GCENGHVPLYSSSSVPTTINTIGTSTSTILSGQAHHSPLKRSVSLTPPMNVPNQPLGHGWMSHEDLRARG    211 - 280
PQCLPSDHAPLSPQSSVASSGSGGSEHLEDQTTARNTFQEEGSGMKDVPAWLKSLRLHKYAALFSQMTYE    281 - 350
EMMALTECQLEAQNVTKGARHKIVISIQKLKERQNLLKSLERDIIEGGSLRIPLQELHQMILTPIKAYSS    351 - 420
PSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPE    421 - 490
GDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKT    491 - 560
LLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTAT    561 - 630
PTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPEFQLPVTEPDINNRLESLC    631 - 700
LSMTEHALGDGVDRTSTI                                                        701 - 718
//

Text Mined References (19)

PMID Year Title