Property Summary

NCBI Gene PubMed Count 58
Grant Count 19
R01 Count 12
Funding $1,418,894.15
PubMed Score 51.02
PubTator Score 53.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.133 0.000
astrocytoma 1.100 0.024
juvenile dermatomyositis 1.124 0.000
diabetes mellitus 2.500 0.001
lung carcinoma 1.100 0.000
acute myeloid leukemia 2.500 0.012
ovarian cancer 1.400 0.008

 GO Component (1)

Gene RIF (48)

PMID Text
26497847 findings suggest that USP22 may be involved in hepatocellular carcinoma progression in cooperation with survivin.
26195632 Data show that the aggregates formed by polyQ-expanded ataxin 7 sequester ubiquitin-specific protease (USP22) through specific interactions.
26143114 the deubiquitinating enzyme activity of USP22 is necessary for regulating HeLa cell growth, and it promotes cell proliferation via the c-Myc/cyclin D2, BMI-1 and p53 pathways in HeLa cells
25971547 Increased USP22 expression in colon cancer correlated with reduced uH2B expression, and this expression pattern may contribute to tumor progression.
25909224 These findings provide evidence that high USP22 expression might be important in tumor progression and serves as an independent molecular marker for poor hepatocellular carcinoma prognosis
25907317 Our data indicated that USP22 may promote lung adenocarcinoma cell invasion by the induction of EMT.
25902005 USP22 attenuated the invasion capacity of colon cancer cells by inhibiting the STAT3/MMP9 signaling pathway.
25817787 findings of the present study suggest a potential mechanism underlying the oncogenic role of USP22 mediated by the modulation of the stability and activity of COX-2
25547493 USP22 is overexpressed in human NSCLC tissues and cell lines. USP22 silencing downregulates MDMX protein expression and activates the p53 pathway.
25546086 These results suggest that USP22 positively regulates RCAN1 levels, which would consequently affect diverse RCAN1-linked cellular processes.
More...

AA Sequence

MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHL      1 - 70
NRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQG     71 - 140
VGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHR    141 - 210
CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKG    211 - 280
DDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVV    281 - 350
NGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR    351 - 420
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQ    421 - 490
WFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE                                       491 - 525
//

Text Mined References (62)

PMID Year Title
26497847 2015 Expression of USP22 and Survivin is an indicator of malignant behavior in hepatocellular carcinoma.
26195632 2015 Aggregation of Polyglutamine-expanded Ataxin 7 Protein Specifically Sequesters Ubiquitin-specific Protease 22 and Deteriorates Its Deubiquitinating Function in the Spt-Ada-Gcn5-Acetyltransferase (SAGA) Complex.
26143114 2015 The deubiquitinating enzyme activity of USP22 is necessary for regulating HeLa cell growth.
25971547 2015 Decreased H2B monoubiquitination and overexpression of ubiquitin-specific protease enzyme 22 in malignant colon carcinoma.
25909224 2015 High USP22 expression indicates poor prognosis in hepatocellular carcinoma.
25907317 2015 USP22 promotes tumor progression and induces epithelial-mesenchymal transition in lung adenocarcinoma.
25902005 2015 Ubiquitin-specific peptidase 22 inhibits colon cancer cell invasion by suppressing the signal transducer and activator of transcription 3/matrix metalloproteinase 9 pathway.
25817787 2015 USP22 acts as an oncogene by regulating the stability of cyclooxygenase-2 in non-small cell lung cancer.
25547493 2014 USP22 promotes NSCLC tumorigenesis via MDMX up-regulation and subsequent p53 inhibition.
25546086 2015 Ubiquitin-specific protease 22 (USP22) positively regulates RCAN1 protein levels through RCAN1 de-ubiquitination.
More...