Property Summary

NCBI Gene PubMed Count 64
PubMed Score 57.87
PubTator Score 53.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 9.8e-13
lung carcinoma 2843 1.6e-04
ovarian cancer 8520 1.7e-04
Multiple myeloma 1332 2.8e-04
diabetes mellitus 1728 1.0e-03
acute myeloid leukemia 783 1.9e-02
astrocytoma 1146 2.4e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.354 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia 1.500 1.9e-02
astrocytoma 1.100 2.4e-02
diabetes mellitus 2.500 1.0e-03
juvenile dermatomyositis 1.124 9.8e-13
lung carcinoma 1.100 1.6e-04
Multiple myeloma 1.133 2.8e-04
ovarian cancer -1.100 1.7e-04

 GO Component (2)

Gene RIF (53)

AA Sequence

MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKSCICHVCGVHL      1 - 70
NRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQG     71 - 140
VGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHR    141 - 210
CEMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKG    211 - 280
DDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVV    281 - 350
NGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR    351 - 420
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQ    421 - 490
WFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE                                       491 - 525
//

Text Mined References (68)

PMID Year Title