Property Summary

NCBI Gene PubMed Count 29
Grant Count 43
R01 Count 25
Funding $2,820,491.91
PubMed Score 55.76
PubTator Score 27.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.100 0.002
psoriasis 1.300 0.000
osteosarcoma -1.502 0.000
posterior fossa group B ependymoma 1.300 0.000
astrocytoma 1.100 0.018
pancreatic ductal adenocarcinoma liver m... 1.052 0.004
lung cancer 1.600 0.000
breast carcinoma 1.300 0.012
diabetes mellitus -1.100 0.002
group 4 medulloblastoma 1.200 0.000
ovarian cancer 2.000 0.000

Gene RIF (7)

PMID Text
26514725 GIV directly and constitutively binds the exocyst complex subunit Exo-70 and also associates with GLUT4-storage vesicles (GSVs) exclusively upon insulin stimulation.
24331928 We show that Exo70, a component of the exocyst complex, undergoes isoform switching mediated by ESRP1, a pre-mRNA splicing factor that regulates epithelial mesenchymal transition.
23948253 Exo70 thus represents a membrane-bending protein that may couple actin dynamics and plasma membrane remodeling for morphogenesis.
23300727 Exo70 is involved in caveolin-1 recycling to the plasma membrane during re-adhesion of the cells to the substratum.
22595671 Exocyst component Exo70 is a direct substrate of the extracellular signal-regulated kinases 1/2, their phosphorylation enhances the binding of Exo70 to other exocyst components and promotes the assembly of the exocyst complex.
22049025 PIPKIgamma and phosphatidyl inositol phosphate pools at nascent E-cadherin contacts cue Exo70 targeting and orient the tethering of exocyst-associated E-cadherin
15705715 BIG2 and Exo70 interact in trans-Golgi network and centrosomes, as well as in exocyst structures or complexes that move along microtubules to the plasma membrane.

AA Sequence

MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL      1 - 70
QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK     71 - 140
LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG    141 - 210
RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLK    211 - 280
QYSQHGLDGKKGGSNLIPLEGLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPL    281 - 350
AGRDDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKA    351 - 420
IVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKE    421 - 490
YNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNL    491 - 560
LSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYI    561 - 630
AEKNLPVFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFL    631 - 700
QKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA                                       701 - 735
//

Text Mined References (34)

PMID Year Title
26514725 2015 GIV/girdin binds exocyst subunit-Exo70 and regulates exocytosis of GLUT4 storage vesicles.
25416956 2014 A proteome-scale map of the human interactome network.
24331928 2013 Exo70 isoform switching upon epithelial-mesenchymal transition mediates cancer cell invasion.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
23948253 2013 Exo70 generates membrane curvature for morphogenesis and cell migration.
23300727 2012 Exo70 subunit of the exocyst complex is involved in adhesion-dependent trafficking of caveolin-1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22595671 2012 ERK1/2 regulate exocytosis through direct phosphorylation of the exocyst component Exo70.
22049025 2012 An association between type I? PI4P 5-kinase and Exo70 directs E-cadherin clustering and epithelial polarization.
21639856 2011 Exo70, a subunit of the exocyst complex, interacts with SNEV(hPrp19/hPso4) and is involved in pre-mRNA splicing.
More...