Property Summary

NCBI Gene PubMed Count 32
PubMed Score 64.54
PubTator Score 27.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 1.8e-02
breast carcinoma 1.300 1.2e-02
diabetes mellitus -1.100 1.7e-03
ependymoma 1.100 1.2e-09
group 4 medulloblastoma 1.100 7.5e-05
lung cancer 1.300 4.4e-03
oligodendroglioma 1.100 2.5e-03
osteosarcoma -1.502 1.9e-04
ovarian cancer -1.100 6.3e-09
pancreatic ductal adenocarcinoma liver m... 1.052 4.0e-03
psoriasis 1.300 7.4e-05

Gene RIF (9)

AA Sequence

MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL      1 - 70
QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK     71 - 140
LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG    141 - 210
RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLK    211 - 280
QYSQHGLDGKKGGSNLIPLEGLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPL    281 - 350
AGRDDMLDVETDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKA    351 - 420
IVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKE    421 - 490
YNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNL    491 - 560
LSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYI    561 - 630
AEKNLPVFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFL    631 - 700
QKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA                                       701 - 735
//

Text Mined References (38)

PMID Year Title