Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
Funding $978,846.59
PubMed Score 22.94
PubTator Score 29.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
lung cancer 1.300 0.004

Gene RIF (10)

PMID Text
26175287 WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis.
25902755 thrombocytopenia with 5'UTR ANKRD26 gene mutation must be considered in case of a constitutional isolated thrombocytopenia, with a low bleeding tendency, associated with autosomal dominant transmission and normal platelet volume.
24628296 The study supports the association of ANKRD26 mutations with thrombocytopenia 2 and a predisposition to myeloid malignancies.
24430186 ANKRD26 regulatory region mutations induce MAPK hyperactivation in familial thrombocytopenia
24030261 Studies indicate that ANKRD26-RT is an insidious form of inherited thrombocytopenias that exposes patients to a low risk of bleeding but predisposes them to hematologic myeloid malignancies.
23869080 the missense mutations may paly a role in the pathogenesis of Autosomal-dominant nonsyndromic thrombocytopenia-2
23223974 Ubiquitin/proteasome-rich particulate cytoplasmic structures are a characteristic feature of ANKRD26-related thrombocytopenia platelets and megakaryocytes.
21467542 The ANKRD26-related thrombocytopenia has to be taken into consideration in the differential diagnosis of isolated thrombocytopenias.
21211618 mutations in the 5' UTR of ANKRD26 are implicated in thrombocytopenia 2.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKKIFSKKGESPLGSFARRQRSSAGGGGEPGEGAYSQPGYHVRDRDLGKIHKAASAGNVAKVQQILLLRK      1 - 70
NGLNDRDKMNRTALHLACANGHPEVVTLLVDRKCQLNVCDNENRTALMKAVQCQEEKCATILLEHGADPN     71 - 140
LADVHGNTALHYAVYNEDISVATKLLLYDANIEAKNKDDLTPLLLAVSGKKQQMVEFLIKKKANVNAVDK    141 - 210
LESSHQLISEYKEERIPKHSSQNSNSVDESSEDSLSRLSGKPGVDDSWPTSDDEDLNFDTKNVPKPSLAK    211 - 280
LMTASQQSRKNLEATYGTVRTGNRTLFEDRDSDSQDEVVVESLPTTSIKVQCFSHPTYQSPDLLPKPSHK    281 - 350
SLANPGLMKEEPTKPGIAKKENGIDIIESAPLEQTNNDNLTYVDEVHKNNRSDMMSALGLGQEEDIESPW    351 - 420
DSESISENFPQKYVDPLAGAADGKEKNIGNEQAEDVFYIPSCMSGSRNFKMAKLEDTRNVGMPVAHMESP    421 - 490
ERYLHLKPTIEMKDSVPNKAGGMKDVQTSKAAEHDLEVASEEEQEREGSENNQPQVEEERKKHRNNEMEV    491 - 560
SANIHDGATDDAEDDDDDDGLIQKRKSGETDHQQFPRKENKEYASGPALQMKEVKSTEKEKRTSKESVNS    561 - 630
PVFGKASLLTGGLLQVDDDSSLSEIDEDEGRPTKKTSNEKNKVKNQIQSMDDVDDLTQSSETASEDCELP    631 - 700
HSSYKNFMLLIEQLGMECKDSVSLLKIQDAALSCERLLELKKNHCELLTVKIKKMEDKVNVLQRELSETK    701 - 770
EIKSQLEHQKVEWERELCSLRFSLNQEEEKRRNADTLYEKIREQLRRKEEQYRKEVEVKQQLELSLQTLE    771 - 840
MELRTVKSNLNQVVQERNDAQRQLSREQNARMLQDGILTNHLSKQKEIEMAQKKMNSENSHSHEEEKDLS    841 - 910
HKNSMLQEEIAMLRLEIDTIKNQNQEKEKKCFEDLKIVKEKNEDLQKTIKQNEETLTQTISQYNGRLSVL    911 - 980
TAENAMLNSKLENEKQSKERLEAEVESYHSRLAAAIHDRDQSETSKRELELAFQRARDECSRLQDKMNFD    981 - 1050
VSNLKDNNEILSQQLFKTESKLNSLEIEFHHTRDALREKTLGLERVQKDLSQTQCQMKEMEQKYQNEQVK   1051 - 1120
VNKYIGKQESVEERLSQLQSENMLLRQQLDDAHNKADNKEKTVINIQDQFHAIVQKLQAESEKQSLLLEE   1121 - 1190
RNKELISECNHLKERQYQYENEKAEREVVVRQLQQELADTLKKQSMSEASLEVTSRYRINLEDETQDLKK   1191 - 1260
KLGQIRNQLQEAQDRHTEAVRCAEKMQDHKQKLEKDNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQ   1261 - 1330
LKKLMELKQSLECNLDQEMKKNVELEREITGFKNLLKMTRKKLNEYENGEFSFHGDLKTSQFEMDIQINK   1331 - 1400
LKHKIDDLTAELETAGSKCLHLDTKNQILQEELLSMKTVQKKCEKLQKNKKKLEQEVINLRSHIERNMVE   1401 - 1470
LGQVKQYKQEIEERARQEIAEKLKEVNLFLQAQAASQENLEQFRENNFASMKSQMELRIKDLESELSKIK   1471 - 1540
TSQEDFNKTELEKYKQLYLEELKVRKSLSSKLTKTNERLAEVNTKLLVEKQQSRSLFTTLTTRPVMEPPC   1541 - 1610
VGNLNNSLDLNRKLIPRENLVISTSNPRASNNSMENYLSKMQQELEKNITRELKEAAAELESGSIASPLG   1611 - 1680
STDESNLNQDLVWKASREYVQVLKKNYMI                                            1681 - 1709
//

Text Mined References (24)

PMID Year Title
26175287 2015 Analyses of Genetic and Clinical Parameters for Screening Patients With Inherited Thrombocytopenia with Small or Normal-Sized Platelets.
25902755 2015 Childhood diagnosis of genetic thrombocytopenia with mutation in the ankyrine repeat domain 26 gene.
24628296 2014 A new family with a germline ANKRD26 mutation and predisposition to myeloid malignancies.
24430186 2014 Thrombocytopenia-associated mutations in the ANKRD26 regulatory region induce MAPK hyperactivation.
24030261 2013 ANKRD26-related thrombocytopenia and myeloid malignancies.
23869080 2013 A missense mutation in ANKRD26 segregates with thrombocytopenia.
23223974 2013 Ubiquitin/proteasome-rich particulate cytoplasmic structures (PaCSs) in the platelets and megakaryocytes of ANKRD26-related thrombo-cytopenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21467542 2011 Mutations in ANKRD26 are responsible for a frequent form of inherited thrombocytopenia: analysis of 78 patients from 21 families.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
More...