Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.87
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.600 0.017
ependymoma -1.400 0.000
glioblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.600 0.003
primitive neuroectodermal tumor -1.700 0.000
pediatric high grade glioma -1.600 0.001
pituitary cancer 1.200 0.000

AA Sequence

MATSQYFDFAQGGGPQYSAQPPTLPLPTVGASYTAQPTPGMDPAVNPAFPPAAPAGYGGYQPHSGQDFAY      1 - 70
GSRPQEPVPTATTMATYQDSYSYGQSAAARSYEDRPYFQSAALQSGRMTAADSGQPGTQEACGQPSPHGS     71 - 140
HSHAQPPQQAPIVESGQPASTLSSGYTYPTATGVQPESSASIVTSYPPPSYNPTCTAYTAPSYPNYDASV    141 - 210
YSAASPFYPPAQPPPPPGPPQQLPPPPAPAGSGSSPRADSKPPLPSKLPRPKAGPRQLQLHYCDICKISC    211 - 280
AGPQTYREHLGGQKHRKKEAAQKTGVQPNGSPRGVQAQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLH    281 - 350
AKLGKPIPTLEPALATESPPGAEAKPTSPTGPSVCASSRPALAKRPVASKALCEGPPEPQAAGCRPQWGK    351 - 420
PAQPKLEGPGAPTQGGSKEAPAGCSDAQPVGPEYVEEVFSDEGRVLRFHCKLCECSFNDLNAKDLHVRGR    421 - 490
RHRLQYRKKVNPDLPIATEPSSRARKVLEERMRKQRHLAEERLEQLRRWHAERRRLEEEPPQDVPPHAPP    491 - 560
DWAQPLLMGRPESPASAPLQPGRRPASSDDRHVMCKHATIYPTEQELLAVQRAVSHAERALKLVSDTLAE    561 - 630
EDRGRREEEGDKRSSVAPQTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLPRQL    631 - 700
QMVTEDEYEVSSDPEANIVISSCEEPRMQVTISVTSPLMREDPSTDPGVEEPQADAGDVLSPKKCLESLA    701 - 770
ALRHARWFQARASGLQPCVIVIRVLRDLCRRVPTWGALPAWAMELLVEKAVSSAAGPLGPGDAVRRVLEC    771 - 840
VATGTLLTDGPGLQDPCERDQTDALEPMTLQEREDVTASAQHALRMLAFRQTHKVLGMDLLPPRHRLGAR    841 - 910
FRKRQRGPGEGEEGAGEKKRGRRGGEGLV                                             911 - 939
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.