Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.97
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 1.3e-03
astrocytic glioma -1.600 1.7e-02
atypical teratoid / rhabdoid tumor -1.800 3.4e-07
ependymoma -1.300 1.9e-09
glioblastoma -1.200 1.4e-06
group 3 medulloblastoma -1.300 1.9e-02
medulloblastoma, large-cell -1.600 3.3e-03
pituitary cancer 1.200 6.7e-06
primitive neuroectodermal tumor -1.700 2.8e-04

AA Sequence

MATSQYFDFAQGGGPQYSAQPPTLPLPTVGASYTAQPTPGMDPAVNPAFPPAAPAGYGGYQPHSGQDFAY      1 - 70
GSRPQEPVPTATTMATYQDSYSYGQSAAARSYEDRPYFQSAALQSGRMTAADSGQPGTQEACGQPSPHGS     71 - 140
HSHAQPPQQAPIVESGQPASTLSSGYTYPTATGVQPESSASIVTSYPPPSYNPTCTAYTAPSYPNYDASV    141 - 210
YSAASPFYPPAQPPPPPGPPQQLPPPPAPAGSGSSPRADSKPPLPSKLPRPKAGPRQLQLHYCDICKISC    211 - 280
AGPQTYREHLGGQKHRKKEAAQKTGVQPNGSPRGVQAQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLH    281 - 350
AKLGKPIPTLEPALATESPPGAEAKPTSPTGPSVCASSRPALAKRPVASKALCEGPPEPQAAGCRPQWGK    351 - 420
PAQPKLEGPGAPTQGGSKEAPAGCSDAQPVGPEYVEEVFSDEGRVLRFHCKLCECSFNDLNAKDLHVRGR    421 - 490
RHRLQYRKKVNPDLPIATEPSSRARKVLEERMRKQRHLAEERLEQLRRWHAERRRLEEEPPQDVPPHAPP    491 - 560
DWAQPLLMGRPESPASAPLQPGRRPASSDDRHVMCKHATIYPTEQELLAVQRAVSHAERALKLVSDTLAE    561 - 630
EDRGRREEEGDKRSSVAPQTRVLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLPRQL    631 - 700
QMVTEDEYEVSSDPEANIVISSCEEPRMQVTISVTSPLMREDPSTDPGVEEPQADAGDVLSPKKCLESLA    701 - 770
ALRHARWFQARASGLQPCVIVIRVLRDLCRRVPTWGALPAWAMELLVEKAVSSAAGPLGPGDAVRRVLEC    771 - 840
VATGTLLTDGPGLQDPCERDQTDALEPMTLQEREDVTASAQHALRMLAFRQTHKVLGMDLLPPRHRLGAR    841 - 910
FRKRQRGPGEGEEGAGEKKRGRRGGEGLV                                             911 - 939
//

Text Mined References (6)

PMID Year Title