Property Summary

NCBI Gene PubMed Count 12
PubMed Score 44.97
PubTator Score 24.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.500 2.6e-05
astrocytic glioma -1.400 1.7e-02
Astrocytoma, Pilocytic -2.600 8.4e-09
atypical teratoid / rhabdoid tumor -2.900 5.8e-08
ependymoma -2.000 2.3e-03
glioblastoma -2.700 3.2e-12
group 3 medulloblastoma -2.100 2.1e-03
lung carcinoma 1.200 1.3e-30
medulloblastoma, large-cell -1.600 3.8e-05
oligodendroglioma -1.500 6.3e-03
ovarian cancer 1.400 1.2e-11
pancreatic cancer -1.100 8.1e-04
pituitary cancer 1.400 2.4e-05
primitive neuroectodermal tumor -2.400 1.1e-04
subependymal giant cell astrocytoma -2.902 3.7e-03

Gene RIF (9)

AA Sequence

MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDKAA      1 - 70
RAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGTVRIWNETVSNLTLMALGSSA     71 - 140
PEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCIYVIPAGESRKIKHLRVFFVTASWSIFAYV    141 - 210
WLYLILAVFSPGVVQVWEALLTLVFFPVCVVFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSI    211 - 280
ELDGTFVGAEAPGELGGLGPGPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSR    281 - 350
AFYRIQATRLMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG    351 - 420
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRVGDA    421 - 490
QGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYR    491 - 560
TVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGISALLLNQGD    561 - 630
GDRKLTAEEEEARRIAEMGKPVLGENCRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAIT    631 - 700
VSAGDEEEEEDGSREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLA    701 - 770
SHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY    771 - 840
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFLGLWLLYILFA    841 - 910
SLEAYCHIRGF                                                               911 - 921
//

Text Mined References (15)

PMID Year Title