Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $197,400
PubMed Score 31.92
PubTator Score 24.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.400 0.017
ependymoma -2.900 0.000
oligodendroglioma -1.500 0.006
glioblastoma -2.800 0.000
group 3 medulloblastoma -2.100 0.002
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -2.400 0.000
pediatric high grade glioma -2.600 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -2.902 0.004
lung carcinoma 1.200 0.000
ovarian cancer 1.400 0.000
pituitary cancer 1.400 0.000
pancreatic cancer -1.100 0.001

Synonym

Accession Q9UPR5 B4DYQ9
Symbols NCX2

Gene

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
23224890 Functional studies, as well as mRNA and protein expression analyses, revealed that NCX1 and NCX3, but not NCX2, were divergently modulated during OPC differentiation into oligodendrocyte.
23224887 the large cytosolic loop of NCX1, NCX2, and NCX3 is involved in acquisition of immunosuppressive drug specificity
23224884 NCX isoforms (NCX2, NCX3) contribute to mitochondrial Na(+)/Ca(2+) exchange in human DAergic neurons and may act downstream of PINK1 in the prevention of neurodegeneration by m[Ca(2+)] accumulation.
21858195 Data suggest that NCX-mediated Ca(2+) fluxes normally exist in human ASM (potentially contributing to rapid Ca(2+) fluxes), and contribute to enhanced [Ca(2+)](i) regulation in airway inflammation.
21382638 Results demonstrate a selective regulation of NCX1, NCX2 and NCX3 isoforms in Alzheimer's disease cortex, specifically in terminals containing amyloid-beta.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20132488 The aim of this study was to investigate if NCX2 might be a tumour suppressor gene involved in glioma. Results indicate that DNA methylation may play a key role in the transcriptional silencing of NCX2.
19913121 Observational study of gene-disease association. (HuGE Navigator)
16679322 plasma membrane Na+/Ca2+ exchangers have inhibitory interactions with the 14-3-3 proteins

AA Sequence

MAPLALVGVTLLLAAPPCSGAATPTPSLPPPPANDSDTSTGGCQGSYRCQPGVLLPVWEPDDPSLGDKAA      1 - 70
RAVVYFVAMVYMFLGVSIIADRFMAAIEVITSKEKEITITKANGETSVGTVRIWNETVSNLTLMALGSSA     71 - 140
PEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVCIYVIPAGESRKIKHLRVFFVTASWSIFAYV    141 - 210
WLYLILAVFSPGVVQVWEALLTLVFFPVCVVFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSI    211 - 280
ELDGTFVGAEAPGELGGLGPGPAEARELDASRREVIQILKDLKQKHPDKDLEQLVGIANYYALLHQQKSR    281 - 350
AFYRIQATRLMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQG    351 - 420
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKELRIGIIDDDIFEEDEHFFVRLLNLRVGDA    421 - 490
QGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGTVDVRVVRSSGARGTVRLPYR    491 - 560
TVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGISALLLNQGD    561 - 630
GDRKLTAEEEEARRIAEMGKPVLGENCRLEVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAIT    631 - 700
VSAGDEEEEEDGSREERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVSILVIGLLTALIGDLA    701 - 770
SHFGCTVGLKDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY    771 - 840
WAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALFLGLWLLYILFA    841 - 910
SLEAYCHIRGF                                                               911 - 921
//

Text Mined References (15)

PMID Year Title
24501278 2014 Exome sequencing identifies de novo gain of function missense mutation in KCND2 in identical twins with autism and seizures that slows potassium channel inactivation.
23506867 The SLC8 gene family of sodium-calcium exchangers (NCX) - structure, function, and regulation in health and disease.
23224890 2013 New roles of NCX in glial cells: activation of microglia in ischemia and differentiation of oligodendrocytes.
23224887 2013 Immunosuppressive drugs, immunophilins, and functional expression of NCX isoforms.
23224884 2013 The role of the mitochondrial NCX in the mechanism of neurodegeneration in Parkinson's disease.
21858195 2011 Sodium-calcium exchange in intracellular calcium handling of human airway smooth muscle.
21382638 2011 High levels of synaptosomal Na(+)-Ca(2+) exchangers (NCX1, NCX2, NCX3) co-localized with amyloid-beta in human cerebral cortex affected by Alzheimer's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20132488 2010 Molecular genetic and epigenetic analysis of NCX2/SLC8A2 at 19q13.3 in human gliomas.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...