Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.11
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.200 2.1e-03
adult high grade glioma -1.200 1.9e-02
astrocytic glioma -1.200 3.3e-02
atypical teratoid / rhabdoid tumor -2.600 6.2e-07
colon cancer -1.800 1.9e-02
dermatomyositis 1.400 6.9e-04
ependymoma -1.100 4.5e-03
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma -1.200 2.6e-04
group 4 medulloblastoma 1.400 2.0e-02
invasive ductal carcinoma -1.200 5.1e-03
lung cancer -1.100 5.0e-02
medulloblastoma, large-cell -1.300 6.2e-03
non-small cell lung cancer -1.061 1.9e-12
osteosarcoma -1.781 4.0e-05
ovarian cancer -3.300 2.3e-12
pancreatic cancer -1.100 2.3e-04
pancreatic carcinoma -1.100 2.3e-04
primary Sjogren syndrome 1.900 5.7e-05
psoriasis -1.800 7.5e-05
subependymal giant cell astrocytoma -1.981 4.4e-02
tuberculosis 1.100 2.0e-07
ulcerative colitis -1.200 1.2e-05
Waldenstrons macroglobulinemia 1.126 3.2e-02

Gene RIF (3)

AA Sequence

MAECGRGGAAGGALPTSPGPALGAKGALKAGVGEGGGGGGRLGHGRARYDSGGVSNGDCSLGVSGDEARA      1 - 70
SPTRGPRGVALAPTPSAVVCTLPRESKPGGLPRRSSIIKDGTKQKRERKKTVSFSSMPTEKKISSASDCI     71 - 140
NSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISD    141 - 210
QISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEID    211 - 280
VDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQ    281 - 350
FSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPE    351 - 420
HKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTM    421 - 490
TSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDV    491 - 560
LKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQF    561 - 630
KEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIV    631 - 700
AMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPK    701 - 770
GSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDE    771 - 840
FIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRT    841 - 910
LWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNL    911 - 980
SEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKE    981 - 1050
RKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEK   1051 - 1120
ANDETGE                                                                  1121 - 1127
//

Text Mined References (23)

PMID Year Title