Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.11
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
pancreatic cancer -1.100 0.000
Waldenstrons macroglobulinemia 1.126 0.032
astrocytic glioma -1.200 0.033
esophageal adenocarcinoma 1.100 0.018
psoriasis -1.800 0.000
glioblastoma -2.100 0.000
osteosarcoma -2.141 0.000
ependymoma -1.100 0.005
group 4 medulloblastoma 1.400 0.020
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -1.300 0.006
tuberculosis 1.100 0.000
non-small cell lung cancer -1.061 0.000
lung cancer -2.600 0.000
colon cancer -1.800 0.019
pediatric high grade glioma -1.500 0.000
primary Sjogren syndrome 1.900 0.000
pancreatic carcinoma -1.100 0.000
subependymal giant cell astrocytoma -1.981 0.044
invasive ductal carcinoma -1.200 0.005
acute myeloid leukemia -1.200 0.002
ulcerative colitis -1.300 0.000
ovarian cancer -3.300 0.000
dermatomyositis 1.400 0.001

Gene RIF (3)

PMID Text
25880423 PLCL2 was identified as a new susceptibility gene for systemic sclerosis.
24916648 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese
19898481 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAECGRGGAAGGALPTSPGPALGAKGALKAGVGEGGGGGGRLGHGRARYDSGGVSNGDCSLGVSGDEARA      1 - 70
SPTRGPRGVALAPTPSAVVCTLPRESKPGGLPRRSSIIKDGTKQKRERKKTVSFSSMPTEKKISSASDCI     71 - 140
NSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISD    141 - 210
QISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEID    211 - 280
VDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQ    281 - 350
FSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPE    351 - 420
HKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTM    421 - 490
TSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDV    491 - 560
LKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQF    561 - 630
KEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIV    631 - 700
AMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPK    701 - 770
GSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDE    771 - 840
FIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRT    841 - 910
LWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNL    911 - 980
SEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKE    981 - 1050
RKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEK   1051 - 1120
ANDETGE                                                                  1121 - 1127
//

Text Mined References (23)

PMID Year Title
25880423 2015 Identification of NF-?B and PLCL2 as new susceptibility genes and highlights on a potential role of IRF8 through interferon signature modulation in systemic sclerosis.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
More...