Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 6
Funding $656,326.66
PubMed Score 6.84
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
23892540 Trinucleotide repeat containing 6B (TNRC6B) rs12484776 associated with uterine fibroid volume in european americans.
23604678 single nucleotide polymorphisms in the TNRC6B gene is associated with uterine fibroid.
20690139 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19549807 Observational study of gene-disease association. (HuGE Navigator)
19383768 Our findings indicate that TNRC6B, is recruited to miRNA targets through an interaction between their N-terminal domain and an Argonaute protein
19117981 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSPSPPVNGGNNA      1 - 70
KRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGGGAGPPPCTAPGANPNNAQVT     71 - 140
GALLQSESGTAPDSTLGGAAASNYANSTWGSGASSNNGTSPNPIHIWDKVIVDGSDMEEWPCIASKDTES    141 - 210
SSENTTDNNSASNPGSEKSTLPGSTTSNKGKGSQCQSASSGNECNLGVWKSDPKAKSVQSSNSTTENNNG    211 - 280
LGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKM    281 - 350
ENAGVNFVVSGREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTG    351 - 420
SVGSWGAARGPSGTDTVSGQSNSGNNGNNGKEREDSWKGASVQKSTGSKNDSWDNNNRSTGGSWNFGPQD    421 - 490
SNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDNQKGHPLPENQGNAQAPCWGR    491 - 560
SSSSTGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHPDCQAVLQTLLSRTDLDPRVLSNTGWGQTQIKQ    561 - 630
DTVWDIEEVPRPEGKSDKGTEGWESAATQTKNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKNTGGWND    631 - 700
YKNNNSSNWGGGRPDEKTPSSWNENPSKDQGWGGGRQPNQGWSSGKNGWGEEVDQTKNSNWESSASKPVS    701 - 770
GWGEGGQNEIGTWGNGGNASLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGSW    771 - 840
GGPPPPPPGNVRPSNSSWSSGPQPATPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPNSYNYKNVNLW    841 - 910
DKNSQGGPAPREPNLPTPMTSKSASVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWGNTPA    911 - 980
NAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEEDGGVWNTTGSQGSASSHNSASWGQGGKKQMKCSL    981 - 1050
KGGNNDSWMNPLAKQFSNMGLLSQTEDNPSSKMDLSVGSLSDKKFDVDKRAMNLGDFNDIMRKDRSGFRP   1051 - 1120
PNSKDMGTTDSGPYFEKLTLPFSNQDGCLGDEAPCSPFSPSPSYKLSPSGSTLPNVSLGAIGTGLNPQNF   1121 - 1190
AARQGGSHGLFGNSTAQSRGLHTPVQPLNSSPSLRAQVPPQFISPQVSASMLKQFPNSGLSPGLFNVGPQ   1191 - 1260
LSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQ   1261 - 1330
PGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWT   1331 - 1400
SMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSK   1401 - 1470
SSNASWPPEFQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSP   1471 - 1540
GAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKP   1541 - 1610
SSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLN   1611 - 1680
LTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLE   1681 - 1750
TGQNQSDPVGPALNLFGGSTGLGQWSSSAGGSSGADLAGASLWGPPNYSSSLWGVPTVEDPHRMGSPAPL   1751 - 1820
LPGDLLGGGSDSI                                                            1821 - 1833
//

Text Mined References (40)

PMID Year Title
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043833 2013 Structural features of Argonaute-GW182 protein interactions.
23892540 2013 Variants in BET1L and TNRC6B associate with increasing fibroid volume and fibroid type among European Americans.
23604678 2013 BET1L and TNRC6B associate with uterine fibroid risk among European Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065704 2013 A meta-analysis of genome-wide association studies to identify prostate cancer susceptibility loci associated with aggressive and non-aggressive disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21984185 2011 miRNA-mediated deadenylation is orchestrated by GW182 through two conserved motifs that interact with CCR4-NOT.
More...