Property Summary

NCBI Gene PubMed Count 30
PubMed Score 7.32
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 1.100 1.6e-02
Alzheimer's disease 1.100 1.5e-02
atypical teratoid / rhabdoid tumor -1.300 9.6e-04
Breast cancer -1.200 2.6e-12
breast carcinoma -1.100 6.5e-25
glioblastoma -1.400 7.0e-05
group 4 medulloblastoma -1.200 7.8e-03
intraductal papillary-mucinous adenoma (... 1.600 4.0e-03
intraductal papillary-mucinous carcinoma... 1.300 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-02
invasive ductal carcinoma -1.100 4.4e-03
juvenile dermatomyositis 1.144 2.8e-08
medulloblastoma, large-cell -1.800 3.0e-05
oligodendroglioma 1.100 1.9e-03
osteosarcoma -1.613 1.2e-04
ovarian cancer -1.400 1.6e-06
Pick disease 1.400 1.5e-07
progressive supranuclear palsy 1.700 5.6e-03
sarcoidosis 1.400 1.3e-02

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSPSPPVNGGNNA      1 - 70
KRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGGGAGPPPCTAPGANPNNAQVT     71 - 140
GALLQSESGTAPDSTLGGAAASNYANSTWGSGASSNNGTSPNPIHIWDKVIVDGSDMEEWPCIASKDTES    141 - 210
SSENTTDNNSASNPGSEKSTLPGSTTSNKGKGSQCQSASSGNECNLGVWKSDPKAKSVQSSNSTTENNNG    211 - 280
LGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKM    281 - 350
ENAGVNFVVSGREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTG    351 - 420
SVGSWGAARGPSGTDTVSGQSNSGNNGNNGKEREDSWKGASVQKSTGSKNDSWDNNNRSTGGSWNFGPQD    421 - 490
SNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDNQKGHPLPENQGNAQAPCWGR    491 - 560
SSSSTGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHPDCQAVLQTLLSRTDLDPRVLSNTGWGQTQIKQ    561 - 630
DTVWDIEEVPRPEGKSDKGTEGWESAATQTKNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKNTGGWND    631 - 700
YKNNNSSNWGGGRPDEKTPSSWNENPSKDQGWGGGRQPNQGWSSGKNGWGEEVDQTKNSNWESSASKPVS    701 - 770
GWGEGGQNEIGTWGNGGNASLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGSW    771 - 840
GGPPPPPPGNVRPSNSSWSSGPQPATPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPNSYNYKNVNLW    841 - 910
DKNSQGGPAPREPNLPTPMTSKSASVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWGNTPA    911 - 980
NAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEEDGGVWNTTGSQGSASSHNSASWGQGGKKQMKCSL    981 - 1050
KGGNNDSWMNPLAKQFSNMGLLSQTEDNPSSKMDLSVGSLSDKKFDVDKRAMNLGDFNDIMRKDRSGFRP   1051 - 1120
PNSKDMGTTDSGPYFEKLTLPFSNQDGCLGDEAPCSPFSPSPSYKLSPSGSTLPNVSLGAIGTGLNPQNF   1121 - 1190
AARQGGSHGLFGNSTAQSRGLHTPVQPLNSSPSLRAQVPPQFISPQVSASMLKQFPNSGLSPGLFNVGPQ   1191 - 1260
LSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQ   1261 - 1330
PGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWT   1331 - 1400
SMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSK   1401 - 1470
SSNASWPPEFQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSP   1471 - 1540
GAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKP   1541 - 1610
SSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLN   1611 - 1680
LTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLE   1681 - 1750
TGQNQSDPVGPALNLFGGSTGLGQWSSSAGGSSGADLAGASLWGPPNYSSSLWGVPTVEDPHRMGSPAPL   1751 - 1820
LPGDLLGGGSDSI                                                            1821 - 1833
//

Text Mined References (42)

PMID Year Title