Property Summary

NCBI Gene PubMed Count 28
PubMed Score 6.84
PubTator Score 9.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
oligodendroglioma 1.100 1.9e-03
osteosarcoma 1.872 5.7e-04
atypical teratoid / rhabdoid tumor -1.500 1.1e-02
glioblastoma -1.600 1.5e-04
group 4 medulloblastoma -1.200 7.8e-03
medulloblastoma, large-cell -2.300 3.3e-04
juvenile dermatomyositis 1.144 2.8e-08
intraductal papillary-mucinous adenoma (... 1.600 4.0e-03
intraductal papillary-mucinous carcinoma... 1.500 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-02
sarcoidosis 1.400 1.3e-02
acute myeloid leukemia 1.100 1.6e-02
breast carcinoma -1.100 6.5e-25
Alzheimer's disease 1.300 1.8e-02
Pick disease 1.700 1.1e-06
progressive supranuclear palsy 1.700 5.6e-03
Breast cancer -1.200 2.6e-12
invasive ductal carcinoma -1.100 4.4e-03
ovarian cancer -1.900 3.1e-08

Protein-protein Interaction (2)

Gene RIF (6)

PMID Text
23892540 Trinucleotide repeat containing 6B (TNRC6B) rs12484776 associated with uterine fibroid volume in european americans.
23604678 single nucleotide polymorphisms in the TNRC6B gene is associated with uterine fibroid.
20690139 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19549807 Observational study of gene-disease association. (HuGE Navigator)
19383768 Our findings indicate that TNRC6B, is recruited to miRNA targets through an interaction between their N-terminal domain and an Argonaute protein
19117981 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSPSPPVNGGNNA      1 - 70
KRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGGGAGPPPCTAPGANPNNAQVT     71 - 140
GALLQSESGTAPDSTLGGAAASNYANSTWGSGASSNNGTSPNPIHIWDKVIVDGSDMEEWPCIASKDTES    141 - 210
SSENTTDNNSASNPGSEKSTLPGSTTSNKGKGSQCQSASSGNECNLGVWKSDPKAKSVQSSNSTTENNNG    211 - 280
LGNWRNVSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETDNSNSSAQVSTVGQTSREQQSKM    281 - 350
ENAGVNFVVSGREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTG    351 - 420
SVGSWGAARGPSGTDTVSGQSNSGNNGNNGKEREDSWKGASVQKSTGSKNDSWDNNNRSTGGSWNFGPQD    421 - 490
SNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDNQKGHPLPENQGNAQAPCWGR    491 - 560
SSSSTGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHPDCQAVLQTLLSRTDLDPRVLSNTGWGQTQIKQ    561 - 630
DTVWDIEEVPRPEGKSDKGTEGWESAATQTKNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKNTGGWND    631 - 700
YKNNNSSNWGGGRPDEKTPSSWNENPSKDQGWGGGRQPNQGWSSGKNGWGEEVDQTKNSNWESSASKPVS    701 - 770
GWGEGGQNEIGTWGNGGNASLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQPPQQPPPPQPEASGSW    771 - 840
GGPPPPPPGNVRPSNSSWSSGPQPATPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPNSYNYKNVNLW    841 - 910
DKNSQGGPAPREPNLPTPMTSKSASVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWGNTPA    911 - 980
NAPNAMKPNSKSMQDGWGESDGPVTGARHPSWEEEEDGGVWNTTGSQGSASSHNSASWGQGGKKQMKCSL    981 - 1050
KGGNNDSWMNPLAKQFSNMGLLSQTEDNPSSKMDLSVGSLSDKKFDVDKRAMNLGDFNDIMRKDRSGFRP   1051 - 1120
PNSKDMGTTDSGPYFEKLTLPFSNQDGCLGDEAPCSPFSPSPSYKLSPSGSTLPNVSLGAIGTGLNPQNF   1121 - 1190
AARQGGSHGLFGNSTAQSRGLHTPVQPLNSSPSLRAQVPPQFISPQVSASMLKQFPNSGLSPGLFNVGPQ   1191 - 1260
LSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQQQQQQQRQ   1261 - 1330
PGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWT   1331 - 1400
SMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSK   1401 - 1470
SSNASWPPEFQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSP   1471 - 1540
GAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKP   1541 - 1610
SSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLN   1611 - 1680
LTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLE   1681 - 1750
TGQNQSDPVGPALNLFGGSTGLGQWSSSAGGSSGADLAGASLWGPPNYSSSLWGVPTVEDPHRMGSPAPL   1751 - 1820
LPGDLLGGGSDSI                                                            1821 - 1833
//

Text Mined References (40)

PMID Year Title
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043833 2013 Structural features of Argonaute-GW182 protein interactions.
23892540 2013 Variants in BET1L and TNRC6B associate with increasing fibroid volume and fibroid type among European Americans.
23604678 2013 BET1L and TNRC6B associate with uterine fibroid risk among European Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23065704 2013 A meta-analysis of genome-wide association studies to identify prostate cancer susceptibility loci associated with aggressive and non-aggressive disease.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21984185 2011 miRNA-mediated deadenylation is orchestrated by GW182 through two conserved motifs that interact with CCR4-NOT.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
21460842 2011 A genome-wide association study identifies three loci associated with susceptibility to uterine fibroids.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21063388 2010 Two PABPC1-binding sites in GW182 proteins promote miRNA-mediated gene silencing.
20690139 2011 Meta-analysis of genome-wide and replication association studies on prostate cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19716330 2009 Mammalian miRNA RISC recruits CAF1 and PABP to affect PABP-dependent deadenylation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19570815 2009 A genome-wide association study of northwestern Europeans involves the C-type natriuretic peptide signaling pathway in the etiology of human height variation.
19549807 2009 Prostate cancer risk associated loci in African Americans.
19383768 2009 The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.
19304925 2009 Importance of the C-terminal domain of the human GW182 protein TNRC6C for translational repression.
19167051 2009 Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.
19117981 2009 Sequence variants at 22q13 are associated with prostate cancer risk.
18690212 2008 Prolyl 4-hydroxylation regulates Argonaute 2 stability.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
16880270 2006 Gawky is a component of cytoplasmic mRNA processing bodies required for early Drosophila development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289642 2005 Identification of novel argonaute-associated proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10591208 1999 The DNA sequence of human chromosome 22.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10409428 1999 Gene expression in proliferating human erythroid cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.