Property Summary

NCBI Gene PubMed Count 10
Grant Count 13
R01 Count 13
Funding $1,235,694.42
PubMed Score 25.07
PubTator Score 17.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.521 0.000
non primary Sjogren syndrome sicca 1.100 0.016
psoriasis -1.100 0.000
non-inflammatory breast cancer -1.100 0.047

Gene RIF (4)

PMID Text
25576919 Data suggest that pyruvate kinase isoform M2 (PKM2)/tripartite motif-containing 35 (TRIM35) expression could be a biomarker for the prognosis of hepatocellular carcinoma (HCC) and target for cancer therapy.
25263439 TRIM35 regulates the Warburg effect and tumorigenicity through interaction with PKM2 in hepatocellular carcinoma.
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of tripartite motif containing 35 (TRIM35) expression as compared to untreated control
14662771 gene located on chromosome 8p21, a region implicated in leukemias and solid tumors; enforced expression inhibited cell growth, clonogenicity, and tumorigenicity; conceivable HLS5 is one of the tumor suppressor genes thought to reside at the 8p21 locus

AA Sequence

MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLR      1 - 70
TNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDT     71 - 140
AHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMA    141 - 210
EETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDV    211 - 280
CKYLGSLQYRVWKKMLASVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRV    281 - 350
FSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL    351 - 420
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEE    421 - 490
LDG                                                                       491 - 493
//

Text Mined References (12)

PMID Year Title
25576919 2015 Co-expression of PKM2 and TRIM35 predicts survival and recurrence in hepatocellular carcinoma.
25263439 2015 TRIM35 Interacts with pyruvate kinase isoform M2 to suppress the Warburg effect and tumorigenicity in hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14662771 2004 HLS5, a novel RBCC (ring finger, B box, coiled-coil) family member isolated from a hemopoietic lineage switch, is a candidate tumor suppressor.
12692137 2003 Cloning and characterization of a novel RING-B-box-coiled-coil protein with apoptotic function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...