Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.71
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 2.2e-04
astrocytic glioma -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -1.700 5.9e-04
Breast cancer 3.800 2.6e-02
cutaneous lupus erythematosus -1.500 5.8e-03
Down syndrome 1.100 2.9e-02
ependymoma -1.300 2.4e-02
glioblastoma -1.600 2.0e-04
invasive ductal carcinoma -1.006 4.3e-03
medulloblastoma, large-cell 1.500 1.7e-03
pancreatic cancer -1.200 2.0e-02
pancreatic carcinoma -1.200 2.0e-02
primitive neuroectodermal tumor 1.600 3.5e-03
subependymal giant cell astrocytoma -3.185 3.6e-03
tuberculosis 1.500 3.9e-05

Pathway (1)

Gene RIF (9)

AA Sequence

MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVP      1 - 70
ELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAV     71 - 140
IFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYET    141 - 210
CATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSS    211 - 280
SVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQ    281 - 350
GMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI    351 - 420
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQWSEATVIANS    421 - 490
AISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVS    491 - 560
LTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQ    561 - 630
NPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPS    631 - 700
VDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGR    701 - 770
TALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS    771 - 840
RRNNNRNNSSGRVPTII                                                         841 - 857
//

Text Mined References (25)

PMID Year Title