Property Summary

NCBI Gene PubMed Count 18
Grant Count 9
Funding $1,393,862.29
PubMed Score 9.19
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 MGI Term (1)

Gene RIF (8)

PMID Text
25496667 Genome-wide shRNA screening identifies AGAP1, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22453919 GTP-binding protein-like domain of AGAP1 is protein binding site that allosterically regulates ArfGAP protein catalytic activity.
18003747 AGAP1 is unique among the AZAPs in its specificity for Arf1, and this activity is dependent on its NH(2)-terminal GTPase-like domain. AGAP1 induce reciprocal activation of Arf6.
16079295 The AGAP1 has been found to associate with the adaptor protein complex AP-3 and regulate the function of AP-3 endosomes.
15892143 Observational study of gene-disease association. (HuGE Navigator)
15892143 CENTG2 is an intriguing candidate gene that merits further scrutiny for its role in autism.
15381706 AGAP1 is a novel binding partner of nitric oxide-sensitive guanylyl cyclase
12388557 overexpression inhibited formation of platelet-derived growth factor-induced ruffles and also induced loss of actin stress fibers

AA Sequence

MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVP      1 - 70
ELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAV     71 - 140
IFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYET    141 - 210
CATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSS    211 - 280
SVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQ    281 - 350
GMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI    351 - 420
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQWSEATVIANS    421 - 490
AISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVS    491 - 560
LTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQ    561 - 630
NPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPS    631 - 700
VDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGR    701 - 770
TALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS    771 - 840
RRNNNRNNSSGRVPTII                                                         841 - 857
//

Text Mined References (24)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22453919 2012 GTP-binding protein-like domain of AGAP1 is protein binding site that allosterically regulates ArfGAP protein catalytic activity.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
18954304 2009 A BAR domain-mediated autoinhibitory mechanism for RhoGAPs of the GRAF family.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...