Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.14
PubTator Score 0.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.135 2.0e-02
active ulcerative colitis 1.353 2.7e-02
adrenocortical carcinoma -1.796 2.0e-03
adult high grade glioma -1.100 3.8e-04
Amyotrophic lateral sclerosis 1.180 7.1e-06
Astrocytoma, Pilocytic -1.200 1.2e-05
atypical teratoid / rhabdoid tumor -2.000 1.4e-02
Breast cancer 3.100 3.7e-02
breast carcinoma -1.600 1.4e-04
cystic fibrosis -1.800 5.4e-04
dermatomyositis 1.200 7.4e-03
Down syndrome 1.300 7.8e-04
glioblastoma -1.200 1.2e-04
group 3 medulloblastoma -2.000 1.9e-04
hereditary spastic paraplegia -1.233 5.7e-03
interstitial cystitis -1.500 6.8e-05
interstitial lung disease -1.400 1.6e-03
invasive ductal carcinoma -1.700 2.6e-02
lung adenocarcinoma -1.400 3.1e-12
lung cancer -5.000 1.7e-06
lung carcinoma -1.200 1.3e-12
medulloblastoma, large-cell -1.300 1.8e-03
non-small cell lung cancer -2.517 1.6e-17
osteosarcoma 1.539 3.3e-02
ovarian cancer -1.800 1.6e-05
Pick disease -1.200 2.0e-03
primitive neuroectodermal tumor -1.100 3.6e-02
progressive supranuclear palsy -1.100 8.7e-03
psoriasis -1.400 4.3e-03
X-linked cerebral adrenoleukodystrophy 1.600 4.7e-02

Gene RIF (2)

AA Sequence

MACPALGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNAIKPGLVKKIN      1 - 70
RLPTPIAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYSRKLKNVLVTIYWLGKAANSC     71 - 140
TSYSGTTLNLKEFEGLLAQMRKDTDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGS    141 - 210
RSRQTPSPDVVLRGSSDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYV    211 - 280
PAPLRKKKAEREEYRKSWSTATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQL    281 - 350
QLINNQLREEDDKWQDDLARWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKE    351 - 420
RRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLR    421 - 490
QQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKV    491 - 560
SVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHGSPLELKQDNGSIEINIKKPNSVPQELAATT    561 - 630
EKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENE    631 - 700
MSGKVELVLSQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQVDSPSSEKSPVMTPQFKFWAWDP    701 - 770
EEERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTVSSSSAD    771 - 840
QLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLTEGALAHSGNP    841 - 910
VSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKTLPLDKSINHQIESPSERRKK    911 - 980
SPREHFQAGPFSPCSPTPPGQSPNRSISGKKLCSSCGLPLGKGAAMIIETLNLYFHIQCFRCGICKGQLG    981 - 1050
DAVSGTDVRIRNGLLNCNDCYMRSRSAGQPTTL                                        1051 - 1083
//

Text Mined References (29)

PMID Year Title