Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.66
PubTator Score 0.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
interstitial lung disease -1.400 0.002
psoriasis -1.400 0.004
osteosarcoma 1.539 0.033
glioblastoma -1.400 0.042
group 3 medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.000 0.014
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.100 0.036
hereditary spastic paraplegia -1.233 0.006
Amyotrophic Lateral Sclerosis 1.180 0.000
adrenocortical carcinoma -1.796 0.002
non-small cell lung cancer -3.588 0.000
X-linked cerebral adrenoleukodystrophy 1.600 0.047
lung cancer -6.700 0.000
active Crohn's disease 1.740 0.006
active ulcerative colitis 1.604 0.024
breast carcinoma -1.600 0.000
Breast cancer 3.100 0.037
interstitial cystitis -1.500 0.000
cystic fibrosis -2.200 0.000
lung adenocarcinoma -2.600 0.000
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.300 0.000
lung carcinoma -1.200 0.000
Pick disease -1.200 0.002
progressive supranuclear palsy -1.100 0.009
invasive ductal carcinoma -2.100 0.016
ovarian cancer -2.100 0.000
Down syndrome 1.300 0.001
dermatomyositis 1.200 0.007

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MACPALGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNAIKPGLVKKIN      1 - 70
RLPTPIAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYSRKLKNVLVTIYWLGKAANSC     71 - 140
TSYSGTTLNLKEFEGLLAQMRKDTDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGS    141 - 210
RSRQTPSPDVVLRGSSDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYV    211 - 280
PAPLRKKKAEREEYRKSWSTATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQL    281 - 350
QLINNQLREEDDKWQDDLARWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKE    351 - 420
RRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLR    421 - 490
QQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKV    491 - 560
SVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHGSPLELKQDNGSIEINIKKPNSVPQELAATT    561 - 630
EKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENE    631 - 700
MSGKVELVLSQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQVDSPSSEKSPVMTPQFKFWAWDP    701 - 770
EEERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTVSSSSAD    771 - 840
QLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLTEGALAHSGNP    841 - 910
VSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKTLPLDKSINHQIESPSERRKK    911 - 980
SPREHFQAGPFSPCSPTPPGQSPNRSISGKKLCSSCGLPLGKGAAMIIETLNLYFHIQCFRCGICKGQLG    981 - 1050
DAVSGTDVRIRNGLLNCNDCYMRSRSAGQPTTL                                        1051 - 1083
//

Text Mined References (28)

PMID Year Title
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...