Property Summary

NCBI Gene PubMed Count 35
Grant Count 10
R01 Count 5
Funding $1,907,119.75
PubMed Score 33.51
PubTator Score 38.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.200 0.000
medulloblastoma, large-cell 1.300 0.000

Gene RIF (23)

PMID Text
26751588 PHF8 reduces the H3K9me2 level at the E2F4 transcriptional start site, demonstrating a direct function of PHF8 in endothelial E2F4 gene regulation
25204660 PHF2 is likely to repress rDNA transcription by competing with PHF8 for binding of ribosomal DNA promoter and by recruiting H3K9me2/3 methyltransferase SUV39H1.
25065740 PHF8 promotes lung cancer cell growth and survival by regulating miR-21.
24146981 knockdown of PHF8 led to a reduction in the number of migratory and invasive cells. Furthermore, downregulation of PHF8 attenuated the tumorigenicity of ESCC cells in vivo.
23979597 PHF8 is regulated by APC(cdc20) and plays an important role in the G2/M transition.
23518351 study identified the histone demethylase PHF8 as a coactivator that is specifically recruited by RAR-alpha fusions to activate expression of their downstream targets upon all-trans retinoic acid treatment in acute promyelocytic leukemia
22850744 Results show that PHF8 controls the expression of genes involved in cell adhesion and cytoskeleton organization such as RhoA, Rac1 and GSK3beta.
22120715 a role of PHF8 in cell migration and invasion
20622854 identification and characterization of an H4K20me1 demethylase, PHF8, has revealed an intimate link between this enzyme and two distinct events in cell cycle progression
20622853 PHF8 demethylates H4K20me1 and H3K9me1 both in vitro and in vivo, and both H3K4me3-binding and catalytic functions of PHF8 are important for its ability to positively regulate gene expression
More...

AA Sequence

MNRSRAIVQRGRVLPPPAPLDTTNLAGRRTLQGRAKMASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSC      1 - 70
VGVEEEKAADIDLYHCPNCEVLHGPSIMKKRRGSSKGHDTHKGKPVKTGSPTFVRELRSRTFDSSDEVIL     71 - 140
KPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGD    141 - 210
FVKYYYSGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYT    211 - 280
DFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIP    281 - 350
TGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHILDIFRGLRE    351 - 420
NRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNI    421 - 490
FGLQRIFPAGSIPLTRPAHSTSVSMSRLSLPSKNGSKKKGLKPKELFKKAERKGKESSALGPAGQLSYNL    491 - 560
MDTYSHQALKTGSFQKAKFNITGACLNDSDDDSPDLDLDGNESPLALLMSNGSTKRVKSLSKSRRTKIAK    561 - 630
KVDKARLMAEQVMEDEFDLDSDDELQIDERLGKEKATLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDI    631 - 700
EEDYTTDEDMVEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSS    701 - 770
SSSPATSSLQAWWTGGQDRSSGSSSSGLGTVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDS    771 - 840
LGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTRVASIETGLA    841 - 910
AAAAKLAQQELQKAQKKKYIKKKPLLKEVEQPRPQDSNLSLTVPAPTVAATPQLVTSSSPLPPPEPKQEA    911 - 980
LSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRIL    981 - 1050
KIHRNGKLLL                                                               1051 - 1060
//

Text Mined References (44)

PMID Year Title
26751588 2016 The Histone Demethylase PHF8 Is Essential for Endothelial Cell Migration.
25204660 2014 PHD finger protein 2 (PHF2) represses ribosomal RNA gene transcription by antagonizing PHF finger protein 8 (PHF8) and recruiting methyltransferase SUV39H1.
25065740 2014 The histone demethylase PHF8 is an oncogenic protein in human non-small cell lung cancer.
24146981 2013 Oncogenic features of PHF8 histone demethylase in esophageal squamous cell carcinoma.
23979597 2013 The G2/M regulator histone demethylase PHF8 is targeted for degradation by the anaphase-promoting complex containing CDC20.
23518351 2013 The histone demethylase PHF8 governs retinoic acid response in acute promyelocytic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
22850744 2012 The histone demethylase PHF8 is essential for cytoskeleton dynamics.
22120715 2012 Systematic knockdown of epigenetic enzymes identifies a novel histone demethylase PHF8 overexpressed in prostate cancer with an impact on cell proliferation, migration and invasion.
More...