Property Summary

NCBI Gene PubMed Count 40
Grant Count 289
R01 Count 177
Funding $41,231,655.09
PubMed Score 1119.06
PubTator Score 165.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.169 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.300 0.003
adult high grade glioma -1.400 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9UPN9 O95855 Q5TG72 Q5TG73 Q5TG74 Q9C017 Q9UJ79
Symbols ECTO
PTC7
RFG7
TF1G
TIF1G
TIFGAMMA
TIF1GAMMA

Gene

PANTHER Protein Class (2)

PDB

3U5M   3U5N   3U5O   3U5P  

Gene RIF (31)

PMID Text
26282171 our work indicates that TIF1gamma exerts its tumor-suppressive functions in part by promoting chromosomal stability.
25961934 our findings reveal a new mechanism by which SOX2-mediated transcription repression of TIF1gamma promotes TGF-beta-induced epithelial-mesenchymal transition in non-small-cell lung cancer
25639486 Tumour suppressor TRIM33 targets nuclear beta-catenin degradation
25381221 Results show that TRIM33 is significantly downregulated in clear renal cell carcinoma tissues which seems to correlate with pathologic stages and grades.
25186009 The dermatomyositis autoantigen TIF1gamma is markedly up-regulated during muscle regeneration in human and mouse muscle cells.
25172487 The ubiquitination of DHX33 by TRIM33 is lysine 63 specific and is required for the formation of the DHX33-NLRP3 inflammasome complex.
25059663 Data indicate that tripartite motif containing 33 protein TIF1gamma promotes sumoylation of SKI-like proto-oncogene protein SnoN1 and regulates epithelial-mesenchymal transition (EMT).
24954480 regulates tumor growth and metastasis through inhibition of TGF-beta/Smad signaling and may serve as a novel prognostic biomarker in hepatocellular carcinoma
24189344 Study suggests TRIM33 and NRAS-CSDE1 as candidate genes for autism, and may provide a novel insight into the etiology of autism
24037894 These studies demonstrate that anti-NXP-2 and anti-TIF-1gamma antibodies are frequent DM specificities (found in 55% of patients) and are present in most patients with cancer-associated dermatomyositis.
More...

AA Sequence

MAENKGGGEAESGGGGSGSAPVTAGAAGPAAQEAEPPLTAVLVEEEEEEGGRAGAEGGAAGPDDGGVAAA      1 - 70
SSGSAQAASSPAASVGTGVAGGAVSTPAPAPASAPAPGPSAGPPPGPPASLLDTCAVCQQSLQSRREAEP     71 - 140
KLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIRCPVCRQECRQIDLVDNYFVKDTSEAPSSSD    141 - 210
EKSEQVCTSCEDNASAVGFCVECGEWLCKTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHK    211 - 280
QEQLKLFCETCDRLTCRDCQLLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKE    281 - 350
VNETNKRVEQEIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI    351 - 420
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIESKPAPGYTPNV    421 - 490
VVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPPAPVPTTTTTTQQHPRQAAPQ    491 - 560
MLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIPGIPRHSGPQYSMMQPHLQRQHSNPGHAGPF    561 - 630
PVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLL    631 - 700
SRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKS    701 - 770
DQVKVKQEPGTEDEICSFSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKI    771 - 840
EPADMNESCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLLCCEKCPKVFH    841 - 910
LTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSPVDQRKCERLLLYLYCHELSI    911 - 980
EFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYAD    981 - 1050
TQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSD   1051 - 1120
ERPVHIK                                                                  1121 - 1127
//

Text Mined References (54)

PMID Year Title
26282171 2015 TIF1? Suppresses Tumor Progression by Regulating Mitotic Checkpoints and Chromosomal Stability.
25961934 2016 Repression of TIF1? by SOX2 promotes TGF-?-induced epithelial-mesenchymal transition in non-small-cell lung cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25639486 2015 Tumour suppressor TRIM33 targets nuclear ?-catenin degradation.
25381221 2015 miR-629 Targets TRIM33 to Promote TGF?/Smad Signaling and Metastatic Phenotypes in ccRCC.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25186009 2015 Expression of the dermatomyositis autoantigen transcription intermediary factor 1? in regenerating muscle.
25172487 2014 The E3 ubiquitin ligase tripartite motif 33 is essential for cytosolic RNA-induced NLRP3 inflammasome activation.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...