Property Summary

NCBI Gene PubMed Count 21
Grant Count 50
R01 Count 21
Funding $3,821,073.31
PubMed Score 32.34
PubTator Score 23.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (9)

PMID Text
26129710 LHX6 inhibits breast cancer cell proliferation and invasion via repression of the Wnt/beta-catenin signaling pathway.
24157876 LHX6 is a putative tumour suppressor gene with epigenetic silencing in lung cancer.
23229549 LHX6 is a transcriptional repressor that interacts with pituitary homeobox 2 (PITX2) to regulate odontogenesis
22435649 found positive association of LHX6 with Tourette syndrome in some European populations, not others. LHX6 demonstrates a high degree of population differentiation and is correlated with the North to South axis of European genetic variation.
21240459 hLHX6.1 could be a new tumor suppressor gene in the cervix.
20428825 Hypermethylation of LHX6 is associated with cervical cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16732332 differentially methylated hypermethylation of LHX6 is a good cancer marker in HNSCC as well as in other kinds of neoplasias and confirm the importance of searching for markers of epigenetic dysregulation in cancer

AA Sequence

MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNIC      1 - 70
SSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYA     71 - 140
SDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPS    141 - 210
EQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQ    211 - 280
HPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGP    281 - 350
LSNRGEKVILFQY                                                             351 - 363
//

Text Mined References (21)

PMID Year Title
26129710 2015 LHX6 inhibits breast cancer cell proliferation and invasion via repression of the Wnt/?-catenin signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24157876 2013 LHX6 acts as a novel potential tumour suppressor with epigenetic inactivation in lung cancer.
23229549 2013 The LIM homeodomain transcription factor LHX6: a transcriptional repressor that interacts with pituitary homeobox 2 (PITX2) to regulate odontogenesis.
22435649 2012 Evaluation of the LIM homeobox genes LHX6 and LHX8 as candidates for Tourette syndrome.
21240459 2011 Epigenetic regulation of the potential tumor suppressor gene, hLHX6.1, in human cervical cancer.
20428825 2010 The role of hLHX6-HMR as a methylation biomarker for early diagnosis of cervical cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
16732332 2006 LHX6 is a sensitive methylation marker in head and neck carcinomas.
More...