Property Summary

NCBI Gene PubMed Count 16
PubMed Score 101.60
PubTator Score 12.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Encephaloclastic Proliferative Vasculopathy 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.832 3.3e-06
adult high grade glioma 1.500 2.8e-04
Astrocytoma, Pilocytic 1.800 1.0e-05
atypical teratoid / rhabdoid tumor 1.100 3.8e-03
ependymoma 1.500 5.3e-08
glioblastoma 1.600 4.7e-08
group 3 medulloblastoma 2.300 2.8e-04
lung cancer -1.100 2.7e-03
lung carcinoma -2.600 9.7e-29
medulloblastoma, large-cell 1.500 1.1e-04
non-small cell lung cancer -1.411 4.0e-14
oligodendroglioma 1.400 1.6e-02
osteosarcoma 1.358 9.8e-04
ovarian cancer 1.500 1.1e-11
pancreatic cancer 1.200 4.9e-03
pancreatic carcinoma 1.200 4.9e-03
pancreatic ductal adenocarcinoma liver m... -1.129 1.3e-02
psoriasis 1.600 2.2e-04

Gene RIF (6)

AA Sequence

MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSS      1 - 70
GPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSAFAIDWLSMCYMLTYIPLLLP     71 - 140
VAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVTVVGQLICSVAQVFILGMPSRIASVWFGANE    141 - 210
VSTACSVAVFGNQLGIAIGFLVPPVLVPNIEDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPP    211 - 280
SRAQSLSYALTSPDASYLGSIARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIG    281 - 350
LTIVIAGMLGAVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP    351 - 420
LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLGAALTAFIKAD    421 - 490
LRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL                                      491 - 526
//

Text Mined References (17)

PMID Year Title