Property Summary

NCBI Gene PubMed Count 24
PubMed Score 35.16
PubTator Score 17.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.200 1.3e-02
atypical teratoid / rhabdoid tumor 1.100 4.0e-07
Bipolar Disorder 1.088 2.3e-02
colon cancer 1.100 6.1e-03
glioblastoma 1.200 2.1e-05
hepatocellular carcinoma 1.200 4.3e-06
intraductal papillary-mucinous neoplasm ... 1.100 5.0e-03
malignant mesothelioma 1.900 5.9e-06
medulloblastoma, large-cell 1.300 2.9e-06
osteosarcoma -1.537 1.0e-05
ovarian cancer 1.300 6.9e-10
pediatric high grade glioma 1.100 2.1e-06
primitive neuroectodermal tumor 1.100 8.2e-05
spina bifida -1.013 2.2e-02

Gene RIF (16)

AA Sequence

MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSC      1 - 70
PQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKL     71 - 140
GYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHL    141 - 210
VVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMAS    211 - 280
RDVMGTKAFPGMLPMGMYGAHIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYL    281 - 350
PDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF    351 - 420
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFTSGLSSTTLPR    421 - 490
FHQAFQ                                                                    491 - 496
//

Text Mined References (25)

PMID Year Title