Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 5
Funding $511,035.04
PubMed Score 48.31
PubTator Score 17.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (14)

PMID Text
25031728 Our findings indicate that PALGL2 serves as a tumor oncoprotein in the development and progression of colorectal cancer
24675530 PLAGL2 expression induces lamellipodia formation and disruption of stress fiber formation.
22076304 PLAGL2 regulate cell cycle and apoptosis via activation of the p53 family member, p73, in human promonocytic U937 cells.
20478531 Transcriptome analysis revealed that these differentiation-suppressive activities are attributable in part to PLAGL2 modulation of Wnt/beta-catenin signaling
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20025940 The data identify PC2 as a novel PLAGL2-binding protein and important mediator of PLAGL2 transactivation.
19574421 Increased cell injury and/or death could be caused directly by the upregulation of bNip3, a preapoptotic molecule that dimerizes with Bcl-2, or indirectly by the aberrant expression of SP-C-induced endoplasmic reticulum stress in epithelial cells.
18655774 These data suggests that Ubc9 can function as a co-factor of PLAGL2, uncoupling from its enzymatic activity, to mediate PLAGL2 interactive SP-C promoter activity.
17950244 This study thus uncovers a novel function of PLAGL2 as an oncoprotein through regulating the stability of Pirh2.
17618602 Nuclear PLAGL2 occupied and transactivated the endogenous SP-C promoter in hypoxic lung cells.These results further suggest that PLAGL2 is an oxidative stress responding regulator in lung cells.
More...

AA Sequence

MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSLPQPEQRPYSC      1 - 70
PQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKL     71 - 140
GYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHL    141 - 210
VVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMAS    211 - 280
RDVMGTKAFPGMLPMGMYGAHIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYL    281 - 350
PDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF    351 - 420
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFTSGLSSTTLPR    421 - 490
FHQAFQ                                                                    491 - 496
//

Text Mined References (23)

PMID Year Title
25031728 2014 The role of pleomorphic adenoma gene-like 2 in gastrointestinal cancer development, progression, and prognosis.
24675530 2014 PLAGL2 regulates actin cytoskeletal architecture and cell migration.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
22076304 2012 Pleomorphic adenoma gene-like 2 regulates expression of the p53 family member, p73, and induces cell cycle block and apoptosis in human promonocytic U937 cells.
20478531 2010 PLAGL2 regulates Wnt signaling to impede differentiation in neural stem cells and gliomas.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20025940 2010 Modulation of PLAGL2 transactivation by positive cofactor 2 (PC2), a component of the ARC/Mediator complex.
19574421 2009 PLAGL2 expression-induced lung epithelium damages at bronchiolar alveolar duct junction in emphysema: bNip3- and SP-C-associated cell death/injury activity.
18655774 2008 Modulation of PLAGL2 transactivation activity by Ubc9 co-activation not SUMOylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...