Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.46
PubTator Score 2.39

Knowledge Summary

Patent (717)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 4.13278239664688E-31
osteosarcoma 7933 0.00514618304013991
Disease Target Count Z-score Confidence
Zellweger Syndrome 38 3.19 1.6
Inguinal hernia 13 3.186 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.144 0.005
psoriasis -1.200 0.000

Synonym

Accession Q9UPE1 Q13583 Q4F970 Q562F5 Q9UM62
Symbols MSSK1
STK23
MSSK-1

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 Collection (1)

Pathway (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25404735 Alternative splicing of the alpha-exon of MEF2C regulates myogenesis. Loss of SRPK3 in rhabdomyosarcoma cells inhibits this splicing and blocks differentiation.
18976975 Knockdown of SRSF protein kinase 3 (SRPK3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK      1 - 70
IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR     71 - 140
ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH    141 - 210
TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR    211 - 280
LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT    281 - 350
SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF    351 - 420
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP    421 - 490
AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL    491 - 560
QHPWLNP                                                                   561 - 567
//

Text Mined References (10)

PMID Year Title
25404735 2015 Alternative splicing of MEF2C pre-mRNA controls its activity in normal myogenesis and promotes tumorigenicity in rhabdomyosarcoma cells.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
21205200 2011 Serine-arginine protein kinases: a small protein kinase family with a large cellular presence.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16140986 2005 Centronuclear myopathy in mice lacking a novel muscle-specific protein kinase transcriptionally regulated by MEF2.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11063724 2000 Large-scale methylation analysis of human genomic DNA reveals tissue-specific differences between the methylation profiles of genes and pseudogenes.