Property Summary

Ligand Count 3
NCBI Gene PubMed Count 6
PubMed Score 2.96
PubTator Score 2.39

Knowledge Summary

Patent (717)

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.1e-31
osteosarcoma 7950 5.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Zellweger syndrome 37 3.199 1.6
Inguinal hernia 14 3.19 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.144 5.1e-03
psoriasis -1.200 4.1e-31

Gene RIF (3)

AA Sequence

MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK      1 - 70
IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR     71 - 140
ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH    141 - 210
TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR    211 - 280
LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT    281 - 350
SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF    351 - 420
TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP    421 - 490
AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL    491 - 560
QHPWLNP                                                                   561 - 567
//

Text Mined References (11)

PMID Year Title