Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.41
PubTator Score 15.47

Knowledge Summary

Patent (3,141)

Expression

Synonym

Accession Q9UPC5 O95853
Symbols LYPSR1

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (7)

PMID Text
27086875 By monitoring fused FLAG-tag and conformation-sensitive native epitope during expression of GPR34 mutants, a tri-basic motif in the first intracellular loop was identified as key topogenic signal that dictates the orientation of transmembrane domain-1.
25673461 GPR34 knockdown impairs the proliferation and migration of HGC-27 gastric cancer cells in vitro and provides a potential implication for therapy of gastric cancer.
23836308 up-regulation of GPR34 expression in human gastric carcinoma may play a critical role in tumor progression and in determining patient prognosis
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of G protein-coupled receptor 34 (GPR34) in peptide-treated PBMCs
22966169 these results are the first to identify a role for a GPR34 in lymphoma cell growth, provide insight into GPR34-mediated signaling, identify a genetically unique subset of MZLs that express high levels of GPR34.
22343749 The present studies confirm that GPR34 is a cellular receptor for LysoPS, especially with a fatty acid at the sn-2 position.
16338117 data show that multiple translation initiation starts and alternative splicing contribute to the supragenomic diversification of GPR34

AA Sequence

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLV      1 - 70
GNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYI     71 - 140
SIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDK    141 - 210
HNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFV    211 - 280
PYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP    281 - 350
SRSESTSEFKPGYSLHDTSVAVKIQSSSKST                                           351 - 381
//

Text Mined References (16)

PMID Year Title
27086875 2016 Topogenesis and cell surface trafficking of GPR34 are facilitated by positive-inside rule that effects through a tri-basic motif in the first intracellular loop.
25673461 2015 G-protein coupled receptor 34 knockdown impairs the proliferation and migration of HGC-27 gastric cancer cells in vitro.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23836308 2013 Upregulation of GPR34 expression affects the progression and prognosis of human gastric adenocarcinoma by PI3K/PDK1/AKT pathway.
22966169 2012 t(X;14)(p11;q32) in MALT lymphoma involving GPR34 reveals a role for GPR34 in tumor cell growth.
22343749 2012 GPR34 is a receptor for lysophosphatidylserine with a fatty acid at the sn-2 position.
16341674 2005 Transcriptome analysis of human gastric cancer.
16338117 2006 Genomic and supragenomic structure of the nucleotide-like G-protein-coupled receptor GPR34.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...