Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.17
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
osteosarcoma 7933 1.33943727100851E-9
psoriasis 6685 0.00170461004516713
limb girdle muscular dystrophy 2I 56 0.00261218868439451
ovarian cancer 8492 0.00338405999200364
lung cancer 4473 0.0359111233039196
Disease Target Count Z-score Confidence
Osteoarthritis 96 3.471 1.7
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 3.211 1.6
Disease Target Count
COG5-CDG 1

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma -3.083 0.000
limb girdle muscular dystrophy 2I -1.053 0.003
lung cancer -1.100 0.036
ovarian cancer 1.500 0.003

Synonym

Accession Q9UP83 A4D0R6 A4D0R7 O14555 O95008 Q6NUL5 COG complex subunit 5
Symbols CDG2I
GTC90
GOLTC1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (8)

PMID Text
25331899 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 Targeted silencing of components of lobe B of the COG complex, namely COG5, COG6, COG7 and COG8, inhibited HIV-1 replication
22615457 In conclusion, we find that GDF5, but not COG5 or MCF2L, influence the extent of radiographic damage in knee osteoarthritis
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20804914 Report on a uterine leiomyoma with a novel HMGA2 fusion gene in a 44-year-old woman.
20112360 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16051600 COG5- and COG7 subunits play distinctive roles in controlling Golgi structure and function
11929878 Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp

AA Sequence

MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLN      1 - 70
EDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGA     71 - 140
LQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNEL    141 - 210
DYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVV    211 - 280
DGYCATLEENINSALDIKVLTQPSQSAVRGGPGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQH    281 - 350
LQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLY    351 - 420
NDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSL    421 - 490
SRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQ    491 - 560
GDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSL    561 - 630
SSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMR    631 - 700
LAADFAQMELAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAEL    701 - 770
KSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ     771 - 839
//

Text Mined References (28)

PMID Year Title
25331899 2014 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 2014 Target silencing of components of the conserved oligomeric Golgi complex impairs HIV-1 replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615457 2012 Genetic contribution to radiographic severity in osteoarthritis of the knee.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20804914 2010 Fusion of HMGA2 to COG5 in uterine leiomyoma.
20112360 2010 A genome-wide association study identifies an osteoarthritis susceptibility locus on chromosome 7q22.
19946888 2010 Defining the membrane proteome of NK cells.
19690088 2009 Deficiency in COG5 causes a moderate form of congenital disorders of glycosylation.
More...