Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
R01 Count 6
Funding $281,938.8
PubMed Score 8.17
PubTator Score 10.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma -3.083 0.000
limb girdle muscular dystrophy 2I -1.053 0.003
lung cancer -1.100 0.036
ovarian cancer 1.500 0.003

Gene RIF (8)

PMID Text
25331899 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 Targeted silencing of components of lobe B of the COG complex, namely COG5, COG6, COG7 and COG8, inhibited HIV-1 replication
22615457 In conclusion, we find that GDF5, but not COG5 or MCF2L, influence the extent of radiographic damage in knee osteoarthritis
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20804914 Report on a uterine leiomyoma with a novel HMGA2 fusion gene in a 44-year-old woman.
20112360 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16051600 COG5- and COG7 subunits play distinctive roles in controlling Golgi structure and function
11929878 Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp

AA Sequence

MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLN      1 - 70
EDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGA     71 - 140
LQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREITKAAQSLNEL    141 - 210
DYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQGLETQNPTQVGTALQVFYNLGTLKDTITSVV    211 - 280
DGYCATLEENINSALDIKVLTQPSQSAVRGGPGRSTMPTPGNTAALRASFWTNMEKLMDHIYAVCGQVQH    281 - 350
LQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLY    351 - 420
NDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDYDPEKALKDSLQPYEAAYLSKSL    421 - 490
SRLFDPINLVFPPGGRNPPSSDELDGIIKTIASELNVAAVDTNLTLAVSKNVAKTIQLYSVKSEQLLSTQ    491 - 560
GDASQVIGPLTEGQRRNVAVVNSLYKLHQSVTKAIHALMENAVQPLLTSVGDAIEAIIITMHQEDFSGSL    561 - 630
SSSGKPDVPCSLYMKELQGFIARVMSDYFKHFECLDFVFDNTEAIAQRAVELFIRHASLIRPLGEGGKMR    631 - 700
LAADFAQMELAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAEL    701 - 770
KSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ     771 - 839
//

Text Mined References (28)

PMID Year Title
25331899 2014 Cog5-Cog7 crystal structure reveals interactions essential for the function of a multisubunit tethering complex.
25179963 2014 Target silencing of components of the conserved oligomeric Golgi complex impairs HIV-1 replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22615457 2012 Genetic contribution to radiographic severity in osteoarthritis of the knee.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20804914 2010 Fusion of HMGA2 to COG5 in uterine leiomyoma.
20112360 2010 A genome-wide association study identifies an osteoarthritis susceptibility locus on chromosome 7q22.
19946888 2010 Defining the membrane proteome of NK cells.
19690088 2009 Deficiency in COG5 causes a moderate form of congenital disorders of glycosylation.
More...