Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
R01 Count 10
Funding $826,017.17
PubMed Score 13.94
PubTator Score 15.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24384427 ADAMTS 8, CCL23, and TNFSF15 are implicated in anti-angiogenic activities
24184540 Study uncovers the tumor suppressive function of ADAMTS8 and its frequent methylation in certain tumors could be developed as a potential biomarker.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17606262 ADAMTS-4 and -8 are inflammatory regulated enzymes expressed in macrophage-rich areas of atherosclerotic plaques
16570050 Immunohistochemistry and Western analysis indicated downregulation of ADAMTS-8 protein in >77% brain tumours. A role for ADAMTS-8 in brain tumorigenesis, warranting further investigation into its role in regulation of tumour angiogenesis.
16152618 ADAMTS8 and ADAMTS15 have emerged as novel predictors of survival in patients with breast carcinoma
15328519 Downdownregulation of METH-2 expression in primary NSCLC, often associated with promoter hypermethylation, is a frequent event, which may be related to the development of the disease.
15296936 Ability of ADAMTS-8 to cleave aggrecan at aggrecanase-susceptible Glu373-Ala374 peptide bond. Presence of ADAMTS-8 mRNA transcripts in normal and osteoarthritic human cartilage. (ADAMTS-8)

AA Sequence

MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAFGKGFVLRLAP      1 - 70
DDSFLAPEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCRGLSGSFLLDGEEFTIQPQGA     71 - 140
GGSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERGDHQEDSEEESQEEEAEGASEPPPPLGATSR    141 - 210
TKRFVSEARFVETLLVADASMAAFYGADLQNHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGP    211 - 280
EVSDNGGLTLRNFCNWQRRFNQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVI    281 - 350
EDEGLQAAHTLAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGG    351 - 420
HGDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKN    421 - 490
GSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQN    491 - 560
GGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNYTDMDGNLLQWVPKYAGVSPRDRCKLFCRAR    561 - 630
GRSEFKVFEAKVIDGTLCGPETLAICVRGQCVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTN    631 - 700
YGYNDIVTIPAGATNIDVKQRSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSI    701 - 770
ATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGD    771 - 840
WSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL                         841 - 889
//

Text Mined References (15)

PMID Year Title
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
24184540 2014 The metalloprotease ADAMTS8 displays antitumor properties through antagonizing EGFR-MEK-ERK signaling and is silenced in carcinomas by CpG methylation.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
17606262 2008 ADAMTS-4 and -8 are inflammatory regulated enzymes expressed in macrophage-rich areas of human atherosclerotic plaques.
16570050 2006 Expression of ADAMTS-8, a secreted protease with antiangiogenic properties, is downregulated in brain tumours.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16152618 2006 ADAMTS8 and ADAMTS15 expression predicts survival in human breast carcinoma.
15328519 2004 METH-2 silencing and promoter hypermethylation in NSCLC.
More...